Bmp7 (NM_001191856) Rat Tagged ORF Clone

CAT#: RR216650

Bmp7 (myc-DDK-tagged) - Rat bone morphogenetic protein 7 (Bmp7)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 412.00


Availability*
2 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Bmp7 (NM_001191856) Rat Tagged ORF Clone
Symbol Bmp7
Synonyms BMP-7; BMP-7
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RR216650 representing NM_001191856
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACGTGCGCTCGCTGCGCGCTGCGGCGCCACACAGCTTCGTGGCGCTCTGGGCGCCTCTGTTCTTGC
TGCGCTCTGCCTTGGCCGACTTCAGCCTGGACAACGAGGTGCACTCCAGTTTCATCCACCGGCGCCTCCG
CAGTCAGGAGCGGCGGGAGATGCAGCGGGAAATCCTGTCCATCTTGGGCTTGCCCCATCGTCCGCGCCCG
CACCTCCAGGGAAAACATAATTCGGCGCCCATGTTCATGTTGGACCTGTACAACGCCATGGCGGTGGAGG
AGAGTGGGCCGGACGGACAGGGCTTCTCCTACCCCTACAAGGCCGTCTTCAGTACCCAGGGTCCCCCTTT
GGCCAGCCTGCAGGACAGCCACTTCCTCACCGACGCCGACATGGTCATGAGCTTCGTCAACCTAGTGGAG
CACGACAAGGAATTCTTCCACCCTCGATACCACCATCGAGAGTTCCGGTTTGATCTTTCCAAGATCCCCG
AGGGAGAGGCGGTGACCGCAGCCGAGTTCAGGATCTATAAGGACTACATCCGGGAGCGGTTTGACAACGA
GACCTTCCAGATCACAGTCTATCAGGTGCTCCAGGAGCACTCAGGCAGGGAGTCCGACCTCTTCTTGCTG
GACAGCCGTACCATCTGGGCTTCTGAGGAGGGCTGGTTGGTATTTGACATCACAGCCACCAGCAACCACT
GGGTGGTCAACCCTCGGCACAACCTGGGCTTACAGCTCTCCGTGGAGACCCTGGATGGGCAGAGCATCAA
CCCCAAGTTGGCAGGCCTGATTGGACGGCATGGACCCCAGAACAAGCAACCCTTCATGGTGGCCTTCTTC
AAGGCCACGGAGGTTCATCTCCGTAGCATCCGGTCCACGGGGGGCAAACAACGCAGCCAGAACCGCTCCA
AGACTCCAAAGAACCAAGAGGCACTGAGGATGGCCAGTGTGGCAGAAAACAGCAGCAGTGACCAGAGGCA
GGCCTGCAAGAAACACGAGCTGTATGTTAGCTTCCGAGACCTTGGCTGGCAGGACTGGATCATCGCACCT
GAAGGCTATGCTGCCTACTACTGTGAGGGAGAGTGTGCCTTCCCTCTGAACTCCTACATGAACGCCACCA
ACCATGCTATCGTCCAGACACTGGTTCACTTCATCAACCCAGACACCGTACCCAAGCCCTGCTGTGCCCC
CACCCAGCTCAACGCGATATCTGTCCTCTACTTCGACGACAGCTCCAACGTCATCCTGAAGAAGTACAGA
AACATGGTGGTCCGGGCCTGTGGCTGCCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RR216650 representing NM_001191856
Red=Cloning site Green=Tags(s)

MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILSILGLPHRPRP
HLQGKHNSAPMFMLDLYNAMAVEESGPDGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVE
HDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNETFQITVYQVLQEHSGRESDLFLL
DSRTIWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFF
KATEVHLRSIRSTGGKQRSQNRSKTPKNQEALRMASVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAP
EGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPDTVPKPCCAPTQLNAISVLYFDDSSNVILKKYR
NMVVRACGCH

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001191856
ORF Size 1290 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001191856.1, NM_001191856.2, NP_001178785
RefSeq Size 2448
RefSeq ORF 1293
Locus ID 85272
Cytogenetics 3q42
MW 49.2 kDa
Gene Summary binds to cell surface heparan sulfate [RGD, Feb 2006]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.