Bnip3l (NM_080888) Rat Tagged ORF Clone

CAT#: RR215204

Bnip3l (Myc-DDK-tagged ORF) - Rat BCL2/adenovirus E1B interacting protein 3-like (Bnip3l), (10 ug)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 402.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Bnip3l (NM_080888) Rat Tagged ORF Clone
Symbol Bnip3l
Synonyms Nix; UV93
Vector pCMV6-Entry
Sequence Data
>RR215204 representing NM_080888
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTCACTTAGTCGAGCCGCCGCCGCCCCTGCACAACAACAACAACAACTGCGAGGAAGGGGAGCAGT
CCCTGCCGCCGCCCGCTGGCCTCAACAGTTCCTGGGTGGAGCTACCCATGAACAGCAGCAATGGCAACGG
TAATGGAAATGGGAAGAATGGGGGCCTGGAGCACGTTCCTTCCTCGTCTTCCATCCACAATGGAGACATG
GAGAAGATCCTTCTGGATGCGCAGCATGAGTCGGGACAGAGCAGCTCAAGAGGCAGTTCTCACTGTGACA
GCCCTTCACCACAAGAAGACGGGCAAATAATGTTTGATGTTGAGATGCACACCAGCAGGGACCACAGCTC
TCAGTCAGAAGAAGAAGTTGTAGATGGAGAAAAAGAAGTTGAGGCTTTGAAGAAAAGTGCAGACTGGGTA
TCAGACTGGTCCAGTAGACCCGAAAACATCCCACCCAAAGAGTTCCATTTCAGACACCCTAAGCGTGCAG
CCTCTCTAAGCATGAGGAAGAGTGGAGCCATGAAGAAAGGGGGCATTTTCTCTGCAGAGTTCCTGAAGGT
CTTCATCCCATCTCTCTTCCTCTCTCACGTGTTGGCTTTGGGGCTGGGCATCTATATCGGAAAACGACTG
AGCACACCTTCTGCCAGCACCTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR215204 representing NM_080888
Red=Cloning site Green=Tags(s)

MSHLVEPPPPLHNNNNNCEEGEQSLPPPAGLNSSWVELPMNSSNGNGNGNGKNGGLEHVPSSSSIHNGDM
EKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVDGEKEVEALKKSADWV
SDWSSRPENIPPKEFHFRHPKRAASLSMRKSGAMKKGGIFSAEFLKVFIPSLFLSHVLALGLGIYIGKRL
STPSASTY

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_080888
ORF Size 654 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_080888.1, NP_543164
RefSeq Size 3219
RefSeq ORF 657
Locus ID 140923
Cytogenetics 15p12
MW 23.7 kDa
Gene Summary may be involved in oligodendroglial lineage cell differentiation; may be involved in apoptosis [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)