Gja1 (NM_012567) Rat Tagged ORF Clone

CAT#: RR213232

Gja1 (Myc-DDK-tagged ORF) - Rat gap junction protein, alpha 1 (Gja1), (10 ug)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 402.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Gja1 (NM_012567) Rat Tagged ORF Clone
Symbol Gja1
Synonyms Cx43; Cx43
Vector pCMV6-Entry
Sequence Data
>RR213232 representing NM_012567
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTGACTGGAGTGCCTTGGGGAAGCTTCTGGACAAGGTCCAAGCCTACTCCACCGCTGGAGGGAAGG
TGTGGCTGTCAGTGCTCTTCATATTCAGAATCCTGCTCCTGGGGACAGCTGTTGAGTCAGCTTGGGGTGA
TGAACAGTCTGCCTTTCGCTGTAACACTCAACAACCTGGCTGCGAAAACGTCTGCTATGACAAGTCCTTC
CCCATCTCTCACGTGCGCTTCTGGGTCCTTCAGATCATATTCGTGTCTGTGCCCACCCTCCTGTACTTGG
CCCATGTGTTCTATGTGATGAGGAAGGAAGAGAAGCTAAACAAGAAAGAAGAGGAGCTCAAAGTGGCCCA
GACTGACGGGGTCAACGTGGAGATGCACCTGAAGCAGATTGAAATCAAGAAGTTCAAGTACGGGATTGAA
GAGCACGGCAAGGTGAAAATGAGGGGCGGCTTGCTGAGAACCTACATCATCAGCATCCTCTTCAAGTCTG
TCTTCGAGGTGGCCTTCCTGCTCATCCAGTGGTACATCTATGGGTTCAGCTTGAGCGCGGTCTACACCTG
CAAGAGAGATCCCTGCCCCCACCAGGTAGACTGCTTCCTCTCACGTCCCACGGAGAAAACCATCTTCATC
ATCTTCATGCTGGTGGTGTCCTTGGTGTCTCTCGCTTTGAACATCATTGAGCTCTTCTACGTCTTCTTCA
AAGGCGTTAAGGATCGCGTGAAGGGAAGAAGCGATCCTTACCACGCCACCACTGGCCCACTGAGCCCATC
AAAAGACTGCGGATCTCCAAAATACGCCTACTTCAATGGCTGCTCCTCACCAACGGCTCCACTCTCGCCT
ATGTCTCCTCCTGGGTACAAGCTGGTTACTGGTGACAGAAACAATTCCTCGTGCCGCAATTACAACAAGC
AAGCTAGCGAGCAAAACTGGGCGAACTACAGCGCAGAGCAAAATCGCATGGGGCAGGCCGGAAGCACCAT
CTCCAACTCGCACGCCCAGCCGTTCGATTTCCCCGACGACAACCAGAATGCCAAAAAAGTTGCTGCTGGA
CATGAACTCCAGCCATTAGCCATCGTGGACCAACGACCTTCCAGCAGAGCCAGCAGCCGCGCCAGCAGCA
GGCCTCGGCCTGATGACCTGGAGATTGGCCTCGGCCTGATGACCTGGAGATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR213232 representing NM_012567
Red=Cloning site Green=Tags(s)

MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGCENVCYDKSF
PISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVEMHLKQIEIKKFKYGIE
EHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSLSAVYTCKRDPCPHQVDCFLSRPTEKTIFI
IFMLVVSLVSLALNIIELFYVFFKGVKDRVKGRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSP
MSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNAKKVAAG
HELQPLAIVDQRPSSRASSRASSRPRPDDLEIGLGLMTWR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_012567
ORF Size 1172 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_012567.2, NP_036699
RefSeq Size 3148
RefSeq ORF 1149
Locus ID 24392
Cytogenetics 20q11
MW 43.5 kDa
Gene Summary gap junction component; plays a role in cell-cell communication [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)