Chrna4 (NM_024354) Rat Tagged ORF Clone

CAT#: RR211661

Chrna4 (Myc-DDK-tagged ORF) - Rat cholinergic receptor, nicotinic, alpha 4 (Chrna4), (10 ug)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 804.00


Availability*
4 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Chrna4 (NM_024354) Rat Tagged ORF Clone
Symbol Chrna4
Synonyms NARAC; NARAC
Vector pCMV6-Entry
Sequence Data
>RR211661 representing NM_024354
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAATTCGGGCCCCGGGGCGCCGCCGCCGCTGCTGCTACTGCCGCTGCTGCTGCTCCTAGGGACCG
GCCTCTTGCCTGCTAGCAGCCACATAGAGACCCGGGCCCATGCGGAGGAGCGGCTCCTGAAGAGACTCTT
CTCCGGTTACAACAAGTGGTCTCGGCCAGTAGGCAATATCTCAGATGTGGTCCTCGTCCGCTTTGGCTTG
TCCATTGCTCAGCTCATTGACGTGGACGAGAAGAACCAGATGATGACAACCAACGTGTGGGTGAAGCAGG
AGTGGCACGACTACAAGCTGCGCTGGGACCCTGGTGACTACGAGAATGTCACCTCCATCCGCATCCCCTC
TGAACTCATCTGGAGGCCTGACATCGTCCTCTACAACAATGCGGATGGAGACTTTGCAGTCACCCACCTG
ACCAAGGCCCACCTGTTCTATGACGGAAGGGTGCAGTGGACACCCCCAGCCATCTATAAGAGCTCCTGCA
GCATCGACGTCACCTTCTTCCCCTTTGACCAGCAGAACTGTACCATGAAGTTTGGATCCTGGACCTACGA
CAAGGCCAAGATTGACTTAGTGAGCATTCATAGCCGTGTGGACCAACTGGACTTCTGGGAAAGTGGGGAG
TGGGTCATCGTGGATGCTGTGGGCACCTACAACACCAGGAAGTACGAGTGCTGTGCCGAGATCTATCCTG
ACATCACCTATGCCTTCATCATCCGACGCCTGCCGCTATTCTACACCATCAACCTCATCATCCCGTGCCT
GCTCATCTCCTGTCTCACCGTGCTGGTCTTCTATCTGCCTTCAGAGTGTGGCGAGAAGGTCACACTGTGC
ATCTCGGTGCTGCTTTCTCTCACCGTCTTCCTGCTGCTCATCACCGAGATCATCCCGTCCACCTCGCTGG
TCATCCCGCTCATCGGCGAGTACCTCCTCTTCACCATGATCTTCGTCACCCTCTCCATCGTCATCACGGT
CTTCGTGCTCAATGTGCACCACCGCTCGCCACGCACACACACGATGCCCGCCTGGGTGCGTAGAGTCTTC
CTGGACATCGTGCCTCGCCTCCTCTTCATGAAGCGCCCCTCTGTGGTCAAAGACAACTGCCGGAGACTTA
TTGAGTCCATGCACAAGATGGCCAACGCCCCCCGCTTCTGGCCAGAGCCTGTGGGCGAGCCCGGCATCTT
GAGTGACATCTGCAACCAAGGTCTGTCACCTGCCCCAACTTTCTGCAACCCCACGGACACAGCAGTCGAG
ACCCAGCCTACGTGCAGGTCACCCCCCCTTGAGGTCCCTGACTTGAAGACATCAGAGGTTGAGAAGGCCA
GTCCCTGTCCATCGCCTGGCTCCTGTCCTCCACCCAAGAGCAGCAGTGGGGCTCCAATGCTCATCAAAGC
CAGGTCCCTGAGTGTCCAGCATGTGCCCAGCTCCCAAGAAGCAGCAGAAGATGGCATCCGCTGCCGGTCT
CGGAGTATCCAGTACTGTGTTTCCCAAGATGGAGCTGCCTCCCTGGCTGACAGCAAGCCCACCAGCTCCC
CGACCTCCCTGAAGGCCCGTCCATCCCAGCTTCCCGTGTCAGACCAGGCCTCTCCATGCAAATGCACATG
CAAGGAACCATCTCCTGTGTCCCCAGTCACTGTGCTCAAGGCGGGAGGCACCAAAGCACCTCCCCAACAC
CTGCCCCTGTCACCAGCCCTGACACGGGCAGTAGAAGGCGTCCAGTACATTGCAGACCACCTCAAGGCAG
AAGACACTGACTTCTCGGTGAAGGAGGACTGGAAATACGTGGCCATGGTCATTGACCGAATCTTCCTCTG
GATGTTCATCATTGTCTGCCTTCTGGGCACTGTGGGACTCTTCCTGCCTCCCTGGCTGGCTGGTATGATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR211661 representing NM_024354
Red=Cloning site Green=Tags(s)

MANSGPGAPPPLLLLPLLLLLGTGLLPASSHIETRAHAEERLLKRLFSGYNKWSRPVGNISDVVLVRFGL
SIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHL
TKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVSIHSRVDQLDFWESGE
WVIVDAVGTYNTRKYECCAEIYPDITYAFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLC
ISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPAWVRRVF
LDIVPRLLFMKRPSVVKDNCRRLIESMHKMANAPRFWPEPVGEPGILSDICNQGLSPAPTFCNPTDTAVE
TQPTCRSPPLEVPDLKTSEVEKASPCPSPGSCPPPKSSSGAPMLIKARSLSVQHVPSSQEAAEDGIRCRS
RSIQYCVSQDGAASLADSKPTSSPTSLKARPSQLPVSDQASPCKCTCKEPSPVSPVTVLKAGGTKAPPQH
LPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPPWLAGMI

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_024354
ORF Size 1890 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_024354.1, NP_077330
RefSeq Size 2149
RefSeq ORF 1893
Locus ID 25590
Cytogenetics 3q43
MW 70.2 kDa
Gene Summary nicotinic acetylcholine receptor subunit responsible for binding calcium sensor protein visinin-like protein-1 (Vilip1), which modulates acetylcholine receptor expression and sensitivity [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)