Gar1 (NM_001024306) Rat Tagged ORF Clone

SKU
RR211245
Gar1 (Myc-DDK-tagged ORF) - Rat nucleolar protein family A, member 1 (H/ACA small nucleolar RNPs) (Nola1), (10 ug)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
4 Weeks*
Specifications
Product Data
Type Rat Tagged ORF Clone
Target Symbol Gar1
Synonyms Nola1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RR211245 representing NM_001024306
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTTTCCGAGGCGGAGGTCGCGGAGGCTTTAATCGCGGTGGTGGAGGTGGAGGCTTCAATCGTGGCG
GCGGCAGCAACAACCACTTCCGAGGGGGCGGCGGCGGTGGTGGCGGCGGCGGCAATTTCAGGGGCGGCGG
CCGAGGAGGATTTGGACGAGGGGGCGGTCGTGGAGGCTTCAATAAATTCCAAGATCAAGGGCCTCCAGAA
CGAGTCGTCTTATTAGGAGAGTTCATGCATCCCTGTGAAGATGACATCGTTTGTAAATGTACCACAGAAG
AAAACAAGGTGCCTTACTTCAATGCTCCTGTTTATTTAGAAAACAAAGAACAAATCGGGAAAGTGGATGA
AATATTTGGACAACTTAGAGATTTTTATTTTTCAGTTAAATTGTCAGAAAACATGAAGGCATCTTCTTTT
AAAAAGCTACAGAAGTTTTACATAGACCCATATAAGCTGCTGCCACTGCAGAGGTTTCTGCCTCGGCCTC
CTGGTGAGAAAGGACCTCCCAGAGGTGGTGGCGGTGGAGGTGGTGGTGGCAGGGGAGGTCGAGGAGGAGG
AAGAGGAGGCGGTGGCCGAGGTGGTGGAAGAGGTGGTGGTTTTAGAGGTGGAAGAGGAGGAGGTGGGGGC
TTCAGAGGAGGAAGAGGAGGAGGCGGCGGATTCCGAGGAAGGGGACAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RR211245 representing NM_001024306
Red=Cloning site Green=Tags(s)

MSFRGGGRGGFNRGGGGGGFNRGGGSNNHFRGGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKFQDQGPPE
RVVLLGEFMHPCEDDIVCKCTTEENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSF
KKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGGGGGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGG
FRGGRGGGGGFRGRGH

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001024306
ORF Size 678 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001024306.1, NP_001019477.1
RefSeq Size 1386 bp
RefSeq ORF 681 bp
Locus ID 499709
UniProt ID Q6AYA1
Cytogenetics 2q43
MW 23 kDa
Summary Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ("psi") residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Gar1 (NM_001024306) Rat Tagged ORF Clone
Your Rating
SKU Description Size Price
RN211245 Gar1 (untagged ORF) - Rat nucleolar protein family A, member 1 (H/ACA small nucleolar RNPs) (Nola1), (10 ug) 10 ug
$330.00
RR211245L3 Lenti ORF clone of Gar1 (Myc-DDK-tagged ORF) - Rat nucleolar protein family A, member 1 (H/ACA small nucleolar RNPs) (Nola1), (10 ug) 10 ug
$630.00
RR211245L4 Lenti ORF clone of Gar1 (mGFP-tagged ORF) - Rat nucleolar protein family A, member 1 (H/ACA small nucleolar RNPs) (Nola1), (10 ug) 10 ug
$630.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.