Cln3 (NM_001006971) Rat Tagged ORF Clone

CAT#: RR210721

Cln3 (Myc-DDK-tagged ORF) - Rat ceroid-lipofuscinosis, neuronal 3 (Cln3), (10 ug)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 557.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cln3 (NM_001006971) Rat Tagged ORF Clone
Symbol Cln3
Synonyms MGC94583
Vector pCMV6-Entry
Sequence Data
>RR210721 representing NM_001006971
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAAGCTCTGAGAGCTCGTGGAGGCGCCTTGAGGATTCTGAGAGGGAGGAGACCGACTCAGAGCCCC
AAACCCCTCCGTTGGATAATCTAAGTGTCCTTTGGAAGAATGCGGTGGGCTTCTGGATCTTGGGGCTTTG
CAACAACTTCTCATATGTGGTGATGCTGAGCGCTGCCCATGACATCCTTAAGCAGGAGCAGGCATCTGGA
AACCAGAGCCATGTGGAACCAGGCCCAACACCCATGCCCCATAACAGCTCATCTCGATTTGATTGCAATT
CAATCTCCACAGCTGCGGTGCTCCTAGCAGACATCCTTCCCACCCTTGTCATCAAACTCCTGGCTCCTCT
TGGCCTTCATTTGCTGCCTTACAGCCCCCGGGTGCTTGTCAGTGGAGTCTGTTCTGCTGGAAGCTTTGTT
CTGGTTGCCTTTTCTCAATCAGTGGGGTTAAGCCTGTGTGGAGTGGTTTTGGCCAGCATCTCATCAGGTC
TAGGGGAGGTCACCTTCCTTTCACTGACTGCCTTCTACCCCAGTGCTGTGATCTCATGGTGGTCTTCAGG
AACTGGGGGTGCAGGGCTTCTTGGATCGCTGTCATACCTGGGGCTCACCCAGGCTGGCCTCTCCCCGCAG
CACACCCTACTTTCTATGCTGGGGATCCCTGTTCTGATGCTAGCCAGCTATTTCTTGCTGCTCACATCTC
CTGAACCCCTGGACCCTGGAGGGCAAGACGAGGCAGAGACTGCTGCCCGGCAGCCTCTCATAGGCACCGA
GACCCCAGAGTCTAGGCCAGGTACCAGCTGGGACCTCTCTCTCCAGGAAAGGTGGACAGTGTTCAAGGGC
CTCTTGCGATACATCATCCCTCTGGTGCTGGTCTACTTTGCAGAATACTTTATCAACCAGGGGCTTTTTG
AGCTCCTGTTTTTCCGGAACACATCCTTAAGTCATGCTCAGCAGTACCGATGGTACCAGATGCTATACCA
GGCTGGTGTGTTCGCTTCCCGCTCTTCTCTCCAGTGTTGCCGAATCCGGTTCACCTGGATCCTAGCCCTG
CTCCAGTGCCTCAACCTGGCCTTCCTGCTGGCAGATGTATGCTTGACCTTCCTGCCCAGCATCTACCTCA
TCTTCATCGTCATTCTGTATGAAGGGCTTCTGGGCGGGGCCGCTTACGTGAATACCTTCCACAACATTGC
CCTGGAGACCAGTGACAAGCACCGAGAGTTTGCCATGGAAGCTGCCTGCATTTCTGACACCTTGGGAATC
TCCCTGTCAGGGGTCCTGGCCTTGCCTCTGCATGACTTCCTCTGCCACCTCCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR210721 representing NM_001006971
Red=Cloning site Green=Tags(s)

MGSSESSWRRLEDSEREETDSEPQTPPLDNLSVLWKNAVGFWILGLCNNFSYVVMLSAAHDILKQEQASG
NQSHVEPGPTPMPHNSSSRFDCNSISTAAVLLADILPTLVIKLLAPLGLHLLPYSPRVLVSGVCSAGSFV
LVAFSQSVGLSLCGVVLASISSGLGEVTFLSLTAFYPSAVISWWSSGTGGAGLLGSLSYLGLTQAGLSPQ
HTLLSMLGIPVLMLASYFLLLTSPEPLDPGGQDEAETAARQPLIGTETPESRPGTSWDLSLQERWTVFKG
LLRYIIPLVLVYFAEYFINQGLFELLFFRNTSLSHAQQYRWYQMLYQAGVFASRSSLQCCRIRFTWILAL
LQCLNLAFLLADVCLTFLPSIYLIFIVILYEGLLGGAAYVNTFHNIALETSDKHREFAMEAACISDTLGI
SLSGVLALPLHDFLCHLP

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001006971
ORF Size 1314 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001006971.1, NP_001006972
RefSeq Size 1704
RefSeq ORF 1317
Locus ID 293485
Cytogenetics 1q36
MW 47.8 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)