Cldn4 (NM_001012022) Rat Tagged ORF Clone

CAT#: RR210685

Cldn4 (Myc-DDK-tagged ORF) - Rat claudin 4 (Cldn4), (10 ug)

Change vector?

  • TrueORF®

USD 402


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cldn4 (NM_001012022) Rat Tagged ORF Clone
Symbol Cldn4
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RR210685 representing NM_001012022
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCCATGGGGCTGCAGGTGCTGGGAATCTCCTTGGCCGTCCTGGGCTGGTTAGGAGTCATCCTGA
GTTGTTCGCTCCCCATGTGGCGGGTGACCGCCTTCATCGGCAGCAACATCGTCACGGCGCAGACGAGCTG
GGAAGGCCTGTGGATGAACTGCGTGGTGCAGAGCACCGGCCAGATGCAGTGCAAGATGTACGACTCGATG
CTGGCCCTGCCGCAGGACCTGCAGGCCGCCCGAGCCCTGATGGTCATCAGCATCATCGTGGGTGCTCTGG
GGATGCTTCTCTCAGTCGTAGGGGGCAAGTGCACCAACTGCATGGAGGACGAGACCGTCAAGGCCAAGGT
CATGATCACAGCCGGAGCCGTGTTCATCGTGGCAAGCATGCTGATTATGGTGCCTGTGTCCTGGACGGCA
CACAACGTCATCCGCGACTTCTACAACCCTCTGGTGGCTTCCGGGCAGAAAAGGGAGATGGGGGCCTCGC
TTTACATCGGCTGGGCGGCTTCTGGGCTGCTGCTCCTGGGAGGAGGCCTCCTCTGCTGCAATTGCCCACC
TCGCCGCAACGAAAAGCCCTACTCCGCCAAGTACTCCGCCGCCCGCTCTGTTCCCGCCAGCAACTATGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RR210685 representing NM_001012022
Red=Cloning site Green=Tags(s)

MASMGLQVLGISLAVLGWLGVILSCSLPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTGQMQCKMYDSM
LALPQDLQAARALMVISIIVGALGMLLSVVGGKCTNCMEDETVKAKVMITAGAVFIVASMLIMVPVSWTA
HNVIRDFYNPLVASGQKREMGASLYIGWAASGLLLLGGGLLCCNCPPRRNEKPYSAKYSAARSVPASNYV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001012022
ORF Size 630 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001012022.1, NP_001012022
RefSeq Size 1824
RefSeq ORF 633
Locus ID 304407
Cytogenetics 12q12
MW 22.9 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations