Gpbar1 (NM_177936) Rat Tagged ORF Clone

CAT#: RR210451

Gpbar1 (Myc-DDK-tagged ORF) - Rat G protein-coupled bile acid receptor 1 (Gpbar1), (10 ug)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 402.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Gpbar1 (NM_177936) Rat Tagged ORF Clone
Symbol Gpbar1
Synonyms Tgr5; Tgr5
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RR210451 representing NM_177936
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGTCACACAACACCACTGAGCTGTCAGCCATTCCCAGAGGGGTTCAGGAGCTTTCCCTGGTCCTGG
CAAGCCTCATCGTCATCGCCAACCTGCTCCTGGCCCTAGGCATTGTCCTGGACCGCCACTTACGCAGCCC
ACCTGCTGGCTGCTTCTTTCTAAGCCTACTACTAGCTGGGCTACTCACAGGGTTGGCACTGCCCACGCTG
CCTGGGCTATGGAATAGGAGCCATCAGGGGTACTGGTCCTGCCTCCTTCTCCACTTGGCCCCCAACTTTT
GTTTCCTCTCCCTGCTTGCCAATCTGCTGCTGGTGCATGGGGAACGCTACATGGCAGTGTTGCAGCCACT
CCGGCCCCATGGGAGTGTGCGGCTAGCCCTGTTCCTCACCTGGATCAGCTCCCTGCTCTTTGCCAGCCTG
CCTGCTCTGGGCTGGAACCACTGGAGTCCTGGTGCCAACTGCAGCTCCCAGGCTATCTTCCCAGCCCCCT
ACCTTTACCTCGAAGTCTATGGGCTCCTGCTGCCCGCTGTGGGGGCCACTGCCCTTCTCTCTGTCCGAGT
GTTGGCCACTGCCCACCACCAGCTGCGGGAGATCCGCAGACTGGAGCGGGCGGTGTGCCGTGATGCACCC
TCAACCCTAGCGAGGGCTCTCACCTGGAGGCAGGCTAGGGCACAGGCAGGAGCCACACTGCTCTTTTTGC
TGTGTTGGGGGCCCTATGTGGCCACATTGCTCCTGTCAGTCTTGGCCTATGAGCGGCGGCCACCACTAGG
GCCTGTAACTCTGTTATCTCTCATCTCATTGGGCAGTGCCAGTGCTGCAGTTGTGCCTGTGGCCATGGGT
CTGGGTGATCAGCGCTACACGGCCCCCTGGAGGACAGCTGCCCAAAGGTGGCTACAAGTGCTTCGAGGAA
GACCCAAGAGGGCCAATCCAGGCCCCAGCACTGCCTACCACTCCAGTAGCCAATGCAGCACTGACTTGGA
CTTGAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RR210451 representing NM_177936
Red=Cloning site Green=Tags(s)

MMSHNTTELSAIPRGVQELSLVLASLIVIANLLLALGIVLDRHLRSPPAGCFFLSLLLAGLLTGLALPTL
PGLWNRSHQGYWSCLLLHLAPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWISSLLFASL
PALGWNHWSPGANCSSQAIFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHHQLREIRRLERAVCRDAP
STLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPVTLLSLISLGSASAAVVPVAMG
LGDQRYTAPWRTAAQRWLQVLRGRPKRANPGPSTAYHSSSQCSTDLDLN

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_177936
ORF Size 987 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_177936.1, NP_808797
RefSeq Size 990
RefSeq ORF 990
Locus ID 338443
Cytogenetics 9q33
MW 35.8 kDa
Gene Summary a bile acid receptor [RGD, Feb 2006].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)