Ap2b1 (NM_080583) Rat Tagged ORF Clone

CAT#: RR209156

Ap2b1 (Myc-DDK-tagged ORF) - Rat adaptor-related protein complex 2, beta 1 subunit (Ap2b1), (10 ug)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 1,216.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Ap2b1 (NM_080583) Rat Tagged ORF Clone
Symbol Ap2b1
Vector pCMV6-Entry
Sequence Data
>RR209156 representing NM_080583
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTGACTCCAAGTACTTCACAACCAATAAGAAGGGAGAAATCTTTGAATTAAAAGCTGAACTCAACA
ATGAAAAGAAAGAAAAGAGGAAGGAGGCTGTGAAGAAAGTGATTGCTGCTATGACCGTGGGGAAGGATGT
GAGCTCTCTCTTCCCAGATGTGGTGAACTGTATGCAGACTGACAACCTGGAACTAAAGAAGCTTGTGTAC
CTCTATCTGATGAACTATGCCAAGAGTCAGCCAGACATGGCCATCATGGCTGTCAACAGCTTTGTGAAGG
ATTGTGAAGACCCCAATCCTTTGATTCGAGCCTTGGCAGTTAGAACCATGGGATGCATCCGGGTGGACAA
GATTACAGAGTATCTCTGTGAACCCCTCCGCAAGTGCTTGAAGGATGAAGACCCCTATGTTCGGAAAACA
GCAGCAGTATGCGTGGCAAAACTCCATGATATCAATGCCCAGATGGTGGAAGATCAGGGATTTCTGGATT
CTCTGCGGGATCTCATAGCAGATTCAAACCCAATGGTGGTGGCTAATGCTGTAGCAGCATTGTCTGAGAT
CAGTGAGTCTCACCCAAACAGCAACTTACTTGATCTGAACCCTCAGAATATCAATAAGCTGCTCACAGCC
CTGAATGAGTGCACTGAGTGGGGCCAGATTTTCATCTTGGACTGCCTGTCTAATTACAACCCTAAAGATG
ACCGGGAAGCTCAGAGCATCTGTGAGCGAGTGACGCCTCGGCTCTCTCATGCCAATTCTGCAGTGGTGCT
TTCAGCAGTAAAAGTTCTGATGAAGTTTCTAGAGTTGTTACCCAAGGACTCTGACTACTACAATATGCTG
CTAAAGAAGCTAGCGCCTCCACTTGTCACTTTGCTCTCTGGGGAGCCAGAAGTGCAGTATGTTGCCCTGA
GGAACATCAACCTAATTGTCCAGAAAAGGCCTGAAATCTTGAAGCAGGAAATCAAGGTCTTCTTTGTGAA
GTACAATGATCCTATCTATGTTAAACTAGAGAAGTTAGACATCATGATTCGTCTTGCATCCCAAGCCAAC
ATTGCTCAGGTTCTGGCAGAACTGAAGGAATATGCCACTGAAGTTGATGTGGACTTTGTTCGCAAAGCTG
TGAGGGCCATTGGACGGTGTGCCATCAAAGTGGAGCAATCAGCAGAACGCTGTGTGAGCACACTGCTTGA
TCTAATCCAGACCAAAGTAAATTATGTGGTCCAAGAGGCAATTGTTGTCATCAGGGACATCTTCCGAAAA
TACCCCAACAAGTATGAGAGCATTATCGCCACGCTGTGTGAGAACTTGGACTCCCTGGATGAACCCGATG
CCCGAGCGGCTATGATTTGGATTGTAGGAGAGTATGCTGAAAGAATCGATAATGCCGATGAGTTACTAGA
GAGCTTCCTGGAAGGTTTTCATGATGAAAGCACCCAGGTGCAGCTCACGTTGCTTACCGCCATAGTGAAA
CTGTTTCTCAAGAAGCCATCAGAAACACAGGAGCTGGTCCAACAGGTCTTGAGCTTGGCCACACAGGATT
CTGATAATCCTGACCTTCGAGATCGGGGTTATATTTATTGGCGCCTTCTTTCAACTGACCCTGTGACAGC
CAAAGAAGTAGTGTTGTCTGAGAAGCCATTGATCTCTGAGGAAACAGACCTCATTGAACCTACCCTCCTG
GATGAGCTCATCTGCCACATTGGTTCTTTGGCCTCCGTGTACCATAAACCTCCGAATGCTTTTGTGGAAG
GGAGCCATGGCATTCATCGCAAACACTTGCCAATTCACCATGGGAGCACTGATGCAGGTGATAGCCCTGT
TGGCACCACCACTGCAACCAACCTGGAACAGCCTCAGGTCATCCCCTCTCAAGGTGACCTTCTGGGGGAT
CTTTTAAATCTTGACCTGGGTCCCCCAGTGAATGTCCCGCAAGTGTCCTCCATGCAGATGGGAGCAGTGG
ATCTTTTAGGAGGAGGACTGGATAGCCTGCTTGGCAGTGACCTTGGCGGGGGCATTGGAGGAAGTCCGGC
AGTAGGACAGTCCTTCATCCCGTCATCAGTGCCTGCAACCTTCGCTCCTTCACCTACTCCTGCTGTGGTC
AGCAGTGGTCTGAATGACCTGTTTGAGCTTTCCACTGGGATAGGCATGGCACCTGGCGGATATGTGGCTC
CTAAGGCAGTCTGGCTACCTGCTGTAAAGGCTAAAGGCTTGGAGATTTCGGGGACGTTTACTCACCGCCA
AGGGCACATCTATATGGAAATGAACTTCACCAACAAAGCTCTGCAGCACATGACGGATTTTGCCATCCAG
TTTAACAAGAATAGCTTCGGTGTCATCCCGAGCACTCCCTTGGCCATACATACTCCGCTGATGCCAAACC
AGAGCATTGATGTGTCTCTGCCTCTCAACACCTTGGGCCCAGTCATGAAGATGGAGCCTCTGAATAACTT
GCAGGTGGCTGTTAAAAACAATATTGATGTCTTCTACTTCAGCTGCCTCATCCCACTCAATGTGCTTTTT
GTAGAAGATGGCAAAATGGAACGCCAGGTCTTCCTTGCGACGTGGAAGGATATTCCCAATGAAAATGAGC
TCCAATTTCAGATTAAGGAGTGTCATTTAAACGCTGACACAGTTTCCAGCAAGTTGCAAAACAACAATGT
TTACACTATCGCCAAGAGGAATGTGGAGGGGCAGGACATGCTGTACCAGTCCCTGAAGCTCACTAATGGC
ATTTGGATTTTGGCAGAGCTGCGGATCCAGCCAGGAAACCCCAATTATACGCTGTCGCTGAAGTGTAGAG
CCCCTGAAGTCTCTCAGTACATCTATCAGGTCTACGACAGCATTTTGAAAAACCCCCTGAAGTCTCTCAG
TACATCTATCAGGTCTACGACAGCATTTTGAAAAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR209156 representing NM_080583
Red=Cloning site Green=Tags(s)

MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVY
LYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKT
AAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTA
LNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNML
LKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQAN
IAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVK
LFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLL
DELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGD
LLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVV
SSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQ
FNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLF
VEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNG
IWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKNPLKSLSTSIRSTTAF*K

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_080583
ORF Size 2906 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_080583.1, NP_542150
RefSeq Size 5413
RefSeq ORF 2856
Locus ID 140670
Cytogenetics 10q26
MW 106.1 kDa
Gene Summary subunit of the clathrin-associated protein complex 2 [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)