Sf3a2 (NM_001011986) Rat Tagged ORF Clone

CAT#: RR208102

  • TrueORF®

Sf3a2 (Myc-DDK-tagged ORF) - Rat splicing factor 3a, subunit 2 (Sf3a2), (10 ug)

  View "NM_001011986" in other vectors (5)

USD 620.00


Availability*
5 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Sf3a2 (NM_001011986) Rat Tagged ORF Clone
Symbol Sf3a2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RR208102 representing NM_001011986
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACTTTCAGCACCGACCTGGAGGCAAAACTGGGAGTGGGGGCGTGGCCTCCTCCTCAGAGAGCAACC
GGGATCGAAGAGAGCGCCTGCGGCAACTGGCCCTGGAAACCATCGACATCAATAAGGACCCGTATTTCAT
GAAGAACCACCTGGGATCCTATGAGTGCAAACTCTGCTTGACTCTGCATAACAATGAGGGGAGCTACCTG
GCCCATACCCAAGGGAAGAAACATCAGACTAACTTGGCCCGGCGAGCTGCCAAGGAGGCCAAAGAAGCCC
CCGCCCAGCCTGCACCAGAGAAGGTCAAGGTGGAGGTGAAGAAGTTTGTGAAGATTGGCCGCCCTGGCTA
CAAAGTGACCAAGCAGAGGGACACAGAGATGGGCCAGCAGAGCCTACTGTTCCAGATTGACTACCCTGAG
ATTGCAGAGGGTGTCATGCCCCGCCACCGCTTCATGTCTGCCTATGAGCAGAGGATCGAGCCCCCGGACC
GCCGCTGGCAGTACCTCCTCATGGCTGCTGAGCCCTATGAGACCATCGCCTTCAAGGTGCCGAGCCGCGA
GATCGACAAGGCTGAGGGCAAGTTTTGGACCCACTGGAACCGAGAGACCAAGCAGTTTTTTCTTCAGTTC
CACTTTAAGATGGAGAAGCCCCCAGCCCCTCCCAGCCTCCCAGCAGGACCCCCAGGCGTCAAGCGGCCCC
CGCCCCCACTCATGAACGGACTACCTCCTCGCCCACCACTCCCTGATGCCTTGCCCCCACCTCCACCTGG
TGGCCTGCCTCTTCCTCCTATGCCCCCCACTGGGCCTGCTCCCTCTGGGCCCCCTGGACCTCCCCAGATG
CCCCCACCAGCTCCTGGGGTACACCCCCCAGCCCCAGTAGTACACCCACCAACATCTGGGGTCCATCCCC
CAGCTCCTGGGGTGCACCCCCCAGCCCCAGTGGTTCATCCACCAACATCTGGGGTCCATCCCCCAGCTCC
TGGGGTCCATCCTCCAGCCCCTGGAGTGCACCCTCCAGCCCCTGGAGTGCACCCACCAGCCCCTGGGGTG
CACCCCCCAGCTCCAGGGGTCCACCCCCCAGCTCCAGGGGTCCACCCCCCAGCTCCAGGGGTCCACCCCC
CAGCTCCAGGGGTCCACCCTCCTCCATCAGCTGGAGTTCATCCTCAGGCTCCAGGGGTGCATCCACCTGC
TCCTGCAGTCCACCCTCAAGCCCCTGGTGTACACCCCCCAGCTCCTGGGATCCACCCTCAGGCACCAGGG
GTGCACCCCCAGCCTCCTCCTGGAGTCCACCCTGCTGCCCCAGGGGTCCATCCTCAGCCTCCAGGGGTTC
ACCCTACTCCTATGCCCCCCATGCTAAGGCCCCCCCTTCCCTCGGATGGCCCTGGGAACATGCCTCCGCC
TCCCCCAGGCAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR208102 representing NM_001011986
Red=Cloning site Green=Tags(s)

MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYL
AHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDTEMGQQSLLFQIDYPE
IAEGVMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQF
HFKMEKPPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPDALPPPPPGGLPLPPMPPTGPAPSGPPGPPQM
PPPAPGVHPPAPVVHPPTSGVHPPAPGVHPPAPVVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGV
HPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPPAPAVHPQAPGVHPPAPGIHPQAPG
VHPQPPPGVHPAAPGVHPQPPGVHPTPMPPMLRPPLPSDGPGNMPPPPPGN

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001011986
ORF Size 1413 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001011986.1, NP_001011986
RefSeq Size 1633
RefSeq ORF 1416
Locus ID 299620
Cytogenetics 7q11
MW 49.9 kDa

Other Versions

Other products for "Sf3a2"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones