Add3 (NM_031552) Rat Tagged ORF Clone

CAT#: RR207822

Reviews ()
Write a review
  • TrueORF®

Add3 (Myc-DDK-tagged ORF) - Rat adducin 3 (gamma) (Add3), (10 ug)



  "NM_031552" in other vectors (3)

USD 910.00


Availability*
5 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Add3 (NM_031552) Rat Tagged ORF Clone
Type Rat Tagged ORF Clone
Tag Myc-DDK
Symbol Add3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RR207822 representing NM_031552
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTTCAGACACCAGCCAAGCGGTGATCACCACCCCTCCTCCTCCCAGCATGCCTCACAAAGAGAGGT
ATTTTGACCGAATCAATGAAAGTGACCCAGAATACCTTCGAGAGAGGAACATGTCTCCTGATCTACGGCA
GGACTTCAATATGATGGAGCAGAGGAAGCGAGTCACTCAGATCCTGCAGAGTCCTGCCTTTCGGGAAGAC
CTAGAGTGCCTCATCCAAGAACAGATGAAGAAAGGCCACGACCCGACCGGATTGCTAGCGTTACAGCAGA
TCGCCGACTACATCATGGCCAACTCCTTCACCGGTTTTTCTTCACCTCCCCTGAGTCTTGGCATGGTCAC
TCCTATTAATGACCTTCCTGGTGCAGACACATCCTCGTATGTGAAGGGAGAGAAGCTCACTCGTTGCAAA
CTCGCCAGCCTGTACAGACTCGCAGATCTGTTTGGGTGGGCACATCTGGCAAATACATACATCTCGGTAC
GAGTAAGTAAGGAGCAGGACCACATCATAATCATCCCCAGAGGCCTCTCTTTCTCTGAAGCCACAGCCTC
TGCTCTGGTGAAGGTCAACATAATAGGAGAAGTGGTGGACCAGGGGAGTACTAATTTGAAAATTGACCAC
TCAGGATTCAGTCCCCATGCTGCAATCTATTCAACCCGTCCCGATGTGAAGTGTGTGATACACATCCACA
CCCTCGCTACAGCAGCTGTGTCTTCCATGAAGTGTGGGATCCTTCCAATTTCCCAAGAGTCTCTCATCCT
GGGAGATGTAGCCTATTATGACTACCAGGGGTCGCTTGATGAGGAGGAGGAAAGAATCGAACTTCAGAAA
GTTCTGGGTCCAAGCTGTAAGGTGCTGGTCCTCAGGAACCATGGCGTGGTAGCTCTTGGAGAAACACTTG
AGGAGGCTTTCCACTACATCTTCAATGTACAGATGGCCTGTGAGATTCAGGTGCAGGCTGTAGCAGGGGC
AGGGGGAGTGGACAATCTTCTCATACTGGATCTTCAGAAATACAAAGCTTTCACCCACGGTGTTGCCATG
ACTGGAGGAGGCGGTGTGAATATGGGTTCCCATCAGAAGTGGAAAGTTGGCGAGATTGAGTTTGAAGGGC
TCATGAGAACCCTGGACAACTTGGGCTACAGAACAGGCTACGCATACAGGCATCCTCTAGTTCGAGAGAA
GCCTCGGCACAAGAGTGACGTGGAGATCCCAGCAACTGTGACTGCATTCTCCTTTGAAGATGATAGTGTG
CCACTCTCTCCCCTCAAGTACATGGCACAGAGACAGCAGCGTGAAAAAACAAGATGGCTGAATTCTCCAA
ATACATACATGAAAGTGAATGTGCCGGAGGAGTCCCGGAACGGGGAAACTAGTCCCAGGACCAAAATAAC
GTGGATGAAAGCAGAGGACCCCTCTAAAGTTAGTAGTGGAACACCTATCAAAATTGAAGATCCCAATCAG
TTTGTTCCTCTAAACACGAACCCGACTGAGGTGCTGGAGAAGAGAAATAAGATTCGGGAACAGAATCGCT
ATGACCTGAAGACAGCAGGGCCACAGTCTCAGCTGCTGGCGGGGATCGTTGTGGACAAACCGCCTTCTAC
CATGCGGTTTGAAGACGATGATCAGGGCCCACCAGCCCCTCCTAACCCATTCAGTCATCTCATGGAAGGA
GAACTTGAAGAATATACGAAGACAATCGAGAGAAAGCAGCAAGGCCTGGACGAAAACCACGAGCTGTTTT
CCAAGAGCTTCACCTCTGTGGATGTGCCTGTCATTGTGAATGGCAAGGACGAGATGCACGATGTTGAAGA
CGAGCTCGCTCAGCGCGTCAGCAGGCTCACGACGAGCACCACCATAGAGAACATCGAGATCACCATCAAG
TCCCCAGACAGAACTGAAGAGGTCCTGTCACCCGATGGCTCGCCTTCAAAGTCACCATCCAAGAAAAAGA
AGAAATTCCGCACACCTTCTTTTCTCAAAAAGAACAAAAAAAAGGAGAAAGTTGAGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR207822 representing NM_031552
Red=Cloning site Green=Tags(s)

MSSDTSQAVITTPPPPSMPHKERYFDRINESDPEYLRERNMSPDLRQDFNMMEQRKRVTQILQSPAFRED
LECLIQEQMKKGHDPTGLLALQQIADYIMANSFTGFSSPPLSLGMVTPINDLPGADTSSYVKGEKLTRCK
LASLYRLADLFGWAHLANTYISVRVSKEQDHIIIIPRGLSFSEATASALVKVNIIGEVVDQGSTNLKIDH
SGFSPHAAIYSTRPDVKCVIHIHTLATAAVSSMKCGILPISQESLILGDVAYYDYQGSLDEEEERIELQK
VLGPSCKVLVLRNHGVVALGETLEEAFHYIFNVQMACEIQVQAVAGAGGVDNLLILDLQKYKAFTHGVAM
TGGGGVNMGSHQKWKVGEIEFEGLMRTLDNLGYRTGYAYRHPLVREKPRHKSDVEIPATVTAFSFEDDSV
PLSPLKYMAQRQQREKTRWLNSPNTYMKVNVPEESRNGETSPRTKITWMKAEDPSKVSSGTPIKIEDPNQ
FVPLNTNPTEVLEKRNKIREQNRYDLKTAGPQSQLLAGIVVDKPPSTMRFEDDDQGPPAPPNPFSHLMEG
ELEEYTKTIERKQQGLDENHELFSKSFTSVDVPVIVNGKDEMHDVEDELAQRVSRLTTSTTIENIEITIK
SPDRTEEVLSPDGSPSKSPSKKKKKFRTPSFLKKNKKKEKVEA

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_031552
ORF Size 2019 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_031552.2, NP_113740.2
RefSeq Size 4098 bp
RefSeq ORF 2022 bp
Locus ID 25230
Cytogenetics 1q55
MW 75.4 kDa
Gene Summary binds phosphatidylserine, binds and is phosphorylated by protein kinase C [RGD, Feb 2006]

Citations (1)

Other Versions

Other products for "Add3"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools