Add3 (NM_031552) Rat Tagged ORF Clone

CAT#: RR207822

Add3 (Myc-DDK-tagged ORF) - Rat adducin 3 (gamma) (Add3), (10 ug)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 855.00


Availability*
4 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Add3 (NM_031552) Rat Tagged ORF Clone
Symbol Add3
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RR207822 representing NM_031552
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTTCAGACACCAGCCAAGCGGTGATCACCACCCCTCCTCCTCCCAGCATGCCTCACAAAGAGAGGT
ATTTTGACCGAATCAATGAAAGTGACCCAGAATACCTTCGAGAGAGGAACATGTCTCCTGATCTACGGCA
GGACTTCAATATGATGGAGCAGAGGAAGCGAGTCACTCAGATCCTGCAGAGTCCTGCCTTTCGGGAAGAC
CTAGAGTGCCTCATCCAAGAACAGATGAAGAAAGGCCACGACCCGACCGGATTGCTAGCGTTACAGCAGA
TCGCCGACTACATCATGGCCAACTCCTTCACCGGTTTTTCTTCACCTCCCCTGAGTCTTGGCATGGTCAC
TCCTATTAATGACCTTCCTGGTGCAGACACATCCTCGTATGTGAAGGGAGAGAAGCTCACTCGTTGCAAA
CTCGCCAGCCTGTACAGACTCGCAGATCTGTTTGGGTGGGCACATCTGGCAAATACATACATCTCGGTAC
GAGTAAGTAAGGAGCAGGACCACATCATAATCATCCCCAGAGGCCTCTCTTTCTCTGAAGCCACAGCCTC
TGCTCTGGTGAAGGTCAACATAATAGGAGAAGTGGTGGACCAGGGGAGTACTAATTTGAAAATTGACCAC
TCAGGATTCAGTCCCCATGCTGCAATCTATTCAACCCGTCCCGATGTGAAGTGTGTGATACACATCCACA
CCCTCGCTACAGCAGCTGTGTCTTCCATGAAGTGTGGGATCCTTCCAATTTCCCAAGAGTCTCTCATCCT
GGGAGATGTAGCCTATTATGACTACCAGGGGTCGCTTGATGAGGAGGAGGAAAGAATCGAACTTCAGAAA
GTTCTGGGTCCAAGCTGTAAGGTGCTGGTCCTCAGGAACCATGGCGTGGTAGCTCTTGGAGAAACACTTG
AGGAGGCTTTCCACTACATCTTCAATGTACAGATGGCCTGTGAGATTCAGGTGCAGGCTGTAGCAGGGGC
AGGGGGAGTGGACAATCTTCTCATACTGGATCTTCAGAAATACAAAGCTTTCACCCACGGTGTTGCCATG
ACTGGAGGAGGCGGTGTGAATATGGGTTCCCATCAGAAGTGGAAAGTTGGCGAGATTGAGTTTGAAGGGC
TCATGAGAACCCTGGACAACTTGGGCTACAGAACAGGCTACGCATACAGGCATCCTCTAGTTCGAGAGAA
GCCTCGGCACAAGAGTGACGTGGAGATCCCAGCAACTGTGACTGCATTCTCCTTTGAAGATGATAGTGTG
CCACTCTCTCCCCTCAAGTACATGGCACAGAGACAGCAGCGTGAAAAAACAAGATGGCTGAATTCTCCAA
ATACATACATGAAAGTGAATGTGCCGGAGGAGTCCCGGAACGGGGAAACTAGTCCCAGGACCAAAATAAC
GTGGATGAAAGCAGAGGACCCCTCTAAAGTTAGTAGTGGAACACCTATCAAAATTGAAGATCCCAATCAG
TTTGTTCCTCTAAACACGAACCCGACTGAGGTGCTGGAGAAGAGAAATAAGATTCGGGAACAGAATCGCT
ATGACCTGAAGACAGCAGGGCCACAGTCTCAGCTGCTGGCGGGGATCGTTGTGGACAAACCGCCTTCTAC
CATGCGGTTTGAAGACGATGATCAGGGCCCACCAGCCCCTCCTAACCCATTCAGTCATCTCATGGAAGGA
GAACTTGAAGAATATACGAAGACAATCGAGAGAAAGCAGCAAGGCCTGGACGAAAACCACGAGCTGTTTT
CCAAGAGCTTCACCTCTGTGGATGTGCCTGTCATTGTGAATGGCAAGGACGAGATGCACGATGTTGAAGA
CGAGCTCGCTCAGCGCGTCAGCAGGCTCACGACGAGCACCACCATAGAGAACATCGAGATCACCATCAAG
TCCCCAGACAGAACTGAAGAGGTCCTGTCACCCGATGGCTCGCCTTCAAAGTCACCATCCAAGAAAAAGA
AGAAATTCCGCACACCTTCTTTTCTCAAAAAGAACAAAAAAAAGGAGAAAGTTGAGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RR207822 representing NM_031552
Red=Cloning site Green=Tags(s)

MSSDTSQAVITTPPPPSMPHKERYFDRINESDPEYLRERNMSPDLRQDFNMMEQRKRVTQILQSPAFRED
LECLIQEQMKKGHDPTGLLALQQIADYIMANSFTGFSSPPLSLGMVTPINDLPGADTSSYVKGEKLTRCK
LASLYRLADLFGWAHLANTYISVRVSKEQDHIIIIPRGLSFSEATASALVKVNIIGEVVDQGSTNLKIDH
SGFSPHAAIYSTRPDVKCVIHIHTLATAAVSSMKCGILPISQESLILGDVAYYDYQGSLDEEEERIELQK
VLGPSCKVLVLRNHGVVALGETLEEAFHYIFNVQMACEIQVQAVAGAGGVDNLLILDLQKYKAFTHGVAM
TGGGGVNMGSHQKWKVGEIEFEGLMRTLDNLGYRTGYAYRHPLVREKPRHKSDVEIPATVTAFSFEDDSV
PLSPLKYMAQRQQREKTRWLNSPNTYMKVNVPEESRNGETSPRTKITWMKAEDPSKVSSGTPIKIEDPNQ
FVPLNTNPTEVLEKRNKIREQNRYDLKTAGPQSQLLAGIVVDKPPSTMRFEDDDQGPPAPPNPFSHLMEG
ELEEYTKTIERKQQGLDENHELFSKSFTSVDVPVIVNGKDEMHDVEDELAQRVSRLTTSTTIENIEITIK
SPDRTEEVLSPDGSPSKSPSKKKKKFRTPSFLKKNKKKEKVEA

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_031552
ORF Size 2019 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_031552.2, NP_113740
RefSeq Size 4098
RefSeq ORF 2022
Locus ID 25230
Cytogenetics 1q55
MW 75.4 kDa
Gene Summary binds phosphatidylserine, binds and is phosphorylated by protein kinase C [RGD, Feb 2006]. Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)