Fbxo21 (NM_001108338) Rat Tagged ORF Clone

CAT#: RR206776

  • TrueORF®

Fbxo21 (Myc-DDK-tagged ORF) - Rat F-box protein 21 (Fbxo21), (10 ug)

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_001108338" in other vectors (3)

Reconstitution Protocol

USD 577.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Fbxo21"

Specifications

Product Data
Type Rat Tagged ORF Clone
Tag Myc-DDK
Symbol Fbxo21
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RR206776 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGTAGCGGGGGACAGCGCTATGGAGGTGGTCCCGGCGCTGGCTGAAGAGGCCGCGGCCGAGG
CGTCGGGCCCCAGCTGCCTGGTGCAACTGCCAGGCGAGGTGCTGGAGTACATCCTGTGCAGCGGCTCGCT
CACGGCGCTCGACATCGGCCGCGTGTCCAGCACCTGCCGCCGCCTGCGCGAGGTGTGCCAGAGCAGCGGG
CAGGTGTGGAAGGAGCAGTTCCGGGTGAGGTGGCCCTCTCTGATGAAGCACTACAGTCCCACTGACTACG
TCAATTGGTTAGAGGAATATAAAGTTCGGCAGAAAGCTGGGTTAGAAGCCCGGAAGATTGTAGCCTCCTT
CTCCAAACGGTTCTTTTCAGAGCACGTTCCTTGTAACGGCTTCAGTGACATTGAGAACCTTGAGGGCCCA
GAGATCTTTTTTGAGGATGAACTGGTGTGCATCCTAAACATGGAAGGAAGGAAAGCTCTGACCTGGAAGT
ACTACGCTAAGAAGATTCTCTACTACCTGCGGCAGCAGAAAATCCTCAACAACCTCAAGGCTTTCCTGCA
GCAGCCAGATGACTACGAGTCCTATCTTGAAGGTGCCGTTTACATCGACCAGTACTGCAACCCGCTCTCC
GACATCAGCCTCAGAGACATCCAGGCCCAGATCCACAGCATCGTGGAGCTTGTGTGCAAAACCCTCCGTG
GCATCAACAGTCGTCACCCGAGCCTGACCTTCAGGGCAGGCGAGTCCTCTATGATAATGGAGATAGAACT
CCAGAGCCAAGTGCTGGACGCCATCAACTATGTCCTGTACGACCAGCTCAAGTTCAAAGGGAACCGCATG
GACTACTACAATGCCTTGAACCTCTACATGCACCAGGTATTGACTCGCAGAACGGGAATCCCCATCAGCA
TGTCTCTGCTCTACCTGACCATCGCCCGGCAGCTGGGCGTCCCTCTGGAGCCTGTCAACTTCCCAAGCCA
CTTCCTGCTGAGGTGGTGCCAAGGCGCAGAAGGGGCAACCCTGGACATCTTCGACTACATCTACATAGAT
GCTTTTGGGAAGGGCAAGCAACTGACAGTGAAAGAGTGTGAGTACTTGATTGGCCAGCACGTGACGGCAG
CTCTCTATGGCGTGGTGAACGTGAAGAAGGTGCTGCAGCGGATGGTGGGCAACCTGCTGAGCCTGGGCAA
GAGGGAAGGCATTGACCAGTCCTACCAGCTCCTCAGAGACTCCTTGGACCTGTACCTGGCGATGTACCCG
GACCAGGTGCAGCTCCTGCTCCTGCAAGCCAGGCTCTACTTCCACCTGGGCATCTGGCCAGAGAAGGTGC
TTGACATCCTCCAGCACATCCAGACCCTCGACCCCGGGCAGCACGGGGCGGTGGGGTATCTAGTGCAGCA
CACGCTAGAGCACATTGAGCGCAAGAAGGAGGAGGTGGGCGTGGAGGTGAAGCTGCGCTCCGAGGAGAAG
CACAGGGATGTCTGCTACTCCATCGGGCTCGTTATGAAGCACAAGAGGTACGGCTACAACTGTGTGATCT
ACGGCTGGGACCCCACGTGCATGATGGGGCACGAGTGGATCCGAAACATGAATGTGCACAGTCTGCCTCA
CGGCCACCATCAGCCCTTCTACAATGTGCTGGTGGAGGACGGCTCCTGCAGATACGCAGCTCAAGAAAAC
CTGGAATACAACGTGGAGCCTCAGGAAATCTCGCACCCAGATGTGGGGCGCTACTTCTCGGAGTTCACGG
GCACACACTACATCCCAAATGCAGAGCTGGAGATCCGGTACCCCGAGGACCTGGAGTTTGTGTATGAGAC
AGTGCAGAACATTTACAGTGCAAAGGAGGACACAGCCGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR206776 protein sequence
Red=Cloning site Green=Tags(s)

MAAVAGDSAMEVVPALAEEAAAEASGPSCLVQLPGEVLEYILCSGSLTALDIGRVSSTCRRLREVCQSSG
QVWKEQFRVRWPSLMKHYSPTDYVNWLEEYKVRQKAGLEARKIVASFSKRFFSEHVPCNGFSDIENLEGP
EIFFEDELVCILNMEGRKALTWKYYAKKILYYLRQQKILNNLKAFLQQPDDYESYLEGAVYIDQYCNPLS
DISLRDIQAQIHSIVELVCKTLRGINSRHPSLTFRAGESSMIMEIELQSQVLDAINYVLYDQLKFKGNRM
DYYNALNLYMHQVLTRRTGIPISMSLLYLTIARQLGVPLEPVNFPSHFLLRWCQGAEGATLDIFDYIYID
AFGKGKQLTVKECEYLIGQHVTAALYGVVNVKKVLQRMVGNLLSLGKREGIDQSYQLLRDSLDLYLAMYP
DQVQLLLLQARLYFHLGIWPEKVLDILQHIQTLDPGQHGAVGYLVQHTLEHIERKKEEVGVEVKLRSEEK
HRDVCYSIGLVMKHKRYGYNCVIYGWDPTCMMGHEWIRNMNVHSLPHGHHQPFYNVLVEDGSCRYAAQEN
LEYNVEPQEISHPDVGRYFSEFTGTHYIPNAELEIRYPEDLEFVYETVQNIYSAKEDTAE

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001108338
ORF Size 1860 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001108338.3, NP_001101808.2
RefSeq Size 3794 bp
RefSeq ORF 1863 bp
Locus ID 360818
Cytogenetics 12q16
MW 71.3 kDa

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.