Tat (NM_012668) Rat Tagged ORF Clone

CAT#: RR206539

Reviews ()
Write a review
  • TrueORF®

Tat (Myc-DDK-tagged ORF) - Rat tyrosine aminotransferase (Tat), nuclear gene encoding mitochondrial protein, (10 ug)



  "NM_012668" in other vectors (3)

Get anti-DDK tag antibody at $68 with code “DDK”. View details.

USD 693.00


Availability*
4 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Tat (NM_012668) Rat Tagged ORF Clone
Type Rat Tagged ORF Clone
Tag Myc-DDK
Symbol Tat
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RR206539 representing NM_012668
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACTCCTACGTGATTCAGACGGATGTCGACGACAGCTTGTCCTCAGTTCTGGATGTGCATGTCAATA
TTGGTGGGAGAAACTCGGTACAAGGAAGAAAGAAAGGCAGGAAGGCCAGATGGGACGTGAGACCCTCTGA
CATGTCCAATAAGACCTTCAATCCCATCCGAGCCATCGTGGACAACATGAAGGTGCAGCCCAATCCGAAC
AAGACCGTGATTTCTCTGTCAATTGGGGACCCTACTGTGTTTGGGAACCTGCCTACAGACCCTGAAGTTA
CCCAAGCCATGAAAGATGCCCTGGACTCGGGGAAGTACAATGGCTATGCCCCGTCCATCGGCTACCTATC
CAGTCGGGAGGAGGTCGCTTCTTACTACCACTGTCATGAGGCTCCTCTGGAAGCTAAGGATGTCATTCTG
ACAAGCGGCTGCAGTCAGGCCATTGAGCTATGTCTAGCTGTGTTGGCCAATCCTGGACAAAACATCCTCA
TTCCAAGGCCCGGGTTTTCCCTCTATAGGACTTTGGCTGAGTCTATGGGAATTGAGGTCAAGCTCTACAA
TCTCCTGCCCGAGAAGTCTTGGGAAATTGACCTAAAACAACTGGAATCTCTGATCGATGAAAAAACAGCG
TGTCTTGTTGTCAACAACCCATCCAATCCCTGTGGCTCCGTGTTCAGTAAGCGGCACCTTCAGAAGATTT
TGGCAGTGGCTGAAAGGCAGTGTGTCCCCATCTTAGCTGACGAGATCTATGGTGACATGGTGTTTTCAGA
TTGCAAATACGAACCACTGGCCAACCTCAGCACCAATGTTCCCATCCTGTCCTGTGGTGGGCTGGCCAAG
CGCTGGCTGGTTCCTGGCTGGAGGTTGGGCTGGATCCTCATTCATGATCGAAGAGACATTTTTGGCAATG
AGATTCGAGACGGGCTGGTGAAACTGAGTCAGCGGATCCTGGGACCATGCACCATAGTCCAGGGTGCTCT
GAAGAGCATCCTTCAGCGAACCCCTCAGGAGTTCTATCACGACACGTTAAGCTTCCTCAAGTCCAATGCG
GACCTCTGCTATGGGGCACTGGCTGCCATCCCTGGACTCCAGCCGGTCCGCCCTTCTGGAGCCATGTACC
TTATGGTGGGAATTGAGATGGAGCATTTCCCGGAATTCGAGAACGACGTGGAGTTCACAGAGCGGTTGAT
TGCGGAGCAGGCTGTCCACTGTCTCCCAGCAACGTGCTTCGAGTACCCAAATTTCTTCCGAGTGGTCATC
ACAGTCCCCGAGGTGATGATGCTGGAGGCTTGTAGCCGGATCCAGGAGTTCTGTGAACAGCACTACCACT
GTGCTGAAGGCAGCCAGGAGGAGTGTGACAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR206539 representing NM_012668
Red=Cloning site Green=Tags(s)

MDSYVIQTDVDDSLSSVLDVHVNIGGRNSVQGRKKGRKARWDVRPSDMSNKTFNPIRAIVDNMKVQPNPN
KTVISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSREEVASYYHCHEAPLEAKDVIL
TSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLLPEKSWEIDLKQLESLIDEKTA
CLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDCKYEPLANLSTNVPILSCGGLAK
RWLVPGWRLGWILIHDRRDIFGNEIRDGLVKLSQRILGPCTIVQGALKSILQRTPQEFYHDTLSFLKSNA
DLCYGALAAIPGLQPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLIAEQAVHCLPATCFEYPNFFRVVI
TVPEVMMLEACSRIQEFCEQHYHCAEGSQEECDK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_012668
ORF Size 1362 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_012668.2, NP_036800.1
RefSeq Size 2037 bp
RefSeq ORF 1365 bp
Locus ID 24813
UniProt ID P04694
Cytogenetics 19q12
MW 50.6 kDa
Gene Summary catalyzes the conversion of L-tyrosine and 2-oxoglutarate to 4-hydroxyphenylpyruvate and L-glutamate; involved in gluconeogenesis [RGD, Feb 2006]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Tat Antibody - C-terminal region
    • 100 ul

USD 396.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools