Yap1 (NM_001034002) Rat Tagged ORF Clone

CAT#: RR205630

Yap1 (Myc-DDK-tagged ORF) - Rat yes-associated protein 1 (Yap1), (10 ug)

Product Images

Circular map for RR205630

Specifications

Product Data

• Type: Rat Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Yap1
• Synonyms: Yap; YAP65
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RR205630 representing NM_001034002
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGAGCCCGCGCAACAGCCGCCGCCCCAGCCGGCCCCGCAAGGCCCCGCGCCGCCGTCGGTGTCTCCGG
  CCGGGACCCCCGCGGCCCCGCCCGCACCCCCGGCGGGTCACCAGGTCGTGCACGTCCGCGGGGACTCGGA
  GACCGACCTGGAAGCGCTTTTCAACGCCGTCATGAACCCCAAGACGGCCAACGTGCCACAGACCGTGCCC
  ATGAGGCTTCGCAAGCTGCCCGACTCCTTCTTCAAGCCGCCTGAGCCCAAGTCCCACTCGCGACAGGCCA
  GTACCGATGCGGGCACTGCTGGAGCCCTGACTCCCCAGCACGTTCGAGCTCACTCGTCTCCAGCCTCCCT
  GCAGCTGGGGGCCGGGACACTCACGGCCAGTGGTGTTGTCTCTGGCCCGGCCGCCACCCCTGCTGCTCAA
  CATCTCAGACAGTCTTCCTTTGAGATCCCTGATGATGTACCATTGCCAGCAGGCTGGGAGATGGCCAAGA
  CCTCTTCTGGTCAGAGATACTTCTTAAATCACAATGATCAGACAACAACATGGCAGGACCCCCGGAAGGC
  CATGCTCTCCCAACTGAACGTTCCTACATCTGCCAGCCCAGCAGTGCCCCAGACGCTGATGAACTCTGCC
  TCAGGGCCTCTTCCTGATGGATGGGAGCAAGCCATGACTCAGGATGGAGAAGTTTACTACATAAACCATA
  AGAACAAGACCACATCCTGGCTGGACCCAAGGCTTGACCCTCGTTTTGCCATGAACCAGAGGATCACTCA
  GAGTGCTCCAGTGAAGCAGCCCCCACCCTTGGCTCCCCAGAGCCCACAGGGAGGCGTCCTGGGTGGAGGC
  AGCTCAAACCAGCAGCAGCAGATACAGCTGCAGCAGCTACAGATGGAGAAGGAGAGGCTGCGATTGAAAC
  AGCAGGAGTTATTTCGGCAGGCAATACGGAATATCAATCCCAGCACAGCAAATGCTCCAAAATGTCAGAC
  CGTCAGAGCGGGAATTAGCTCTCCGCAGCCAGTTGCCCTCACTGGAGCAGGATGGAGGGACTCAGAATGC
  AGTGTCTTCTCCCGGGATGACTCAGGAATTGAGGACAATGACAACCAA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RR205630 representing NM_001034002
  Red=Cloning site Green=Tags(s)
  
  MEPAQQPPPQPAPQGPAPPSVSPAGTPAAPPAPPAGHQVVHVRGDSETDLEALFNAVMNPKTANVPQTVP
  MRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAGTLTASGVVSGPAATPAAQ
  HLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHNDQTTTWQDPRKAMLSQLNVPTSASPAVPQTLMNSA
  SGPLPDGWEQAMTQDGEVYYINHKNKTTSWLDPRLDPRFAMNQRITQSAPVKQPPPLAPQSPQGGVLGGG
  SSNQQQQIQLQQLQMEKERLRLKQQELFRQAIRNINPSTANAPKCQTVRAGISSPQPVALTGAGWRDSEC
  SVFSRDDSGIEDNDNQ
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001034002
• ORF Size: 1098 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001034002.2, NP_001029174.2
• RefSeq Size: 1471 bp
• RefSeq ORF: 1101 bp
• Locus ID: 363014
• UniProt ID: Q2EJA0
• Cytogenetics: 8q11
• MW: 39.2 kDa
• Gene Summary: Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Plays a key role in tissue tension and 3D tissue shape by regulating cortical actomyosin network formation. Acts via ARHGAP18, a Rho GTPase activating protein that suppresses F-actin polymerization. Plays a key role to control cell proliferation in response to cell contact. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. The presence of TEAD transcription factors are required for it to stimulate gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction (By similarity). Isoform 2, isoform 3 and isoform 4 (lacking the C-terminal transactivation domain) can attenuate p73-mediated cell death signaling in transcriptional repression-induced atypical death (TRIAD) of neurons (PubMed:16461361).[UniProtKB/Swiss-Prot Function]