Acvrl1 (NM_022441) Rat Tagged ORF Clone

CAT#: RR205137

Acvrl1 (Myc-DDK-tagged ORF) - Rat activin A receptor type II-like 1 (Acvrl1), (10 ug)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 639.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Acvrl1 (NM_022441) Rat Tagged ORF Clone
Symbol Acvrl1
Synonyms R-3; R3; SETHKIR
Vector pCMV6-Entry
Sequence Data
>RR205137 representing NM_022441
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCCTGGGGATTTTCCGAAGGGTCTTTTTGATGCTGTCGGTGGCCTTGGGCCTAACTAAGGGAGACT
TGGTGAAGCCCTCCAGGGGTCAGCTGGTAAACTGCACTTGTGAGAACCCACACTGCAAGAGGCCAATCTG
CCAGGGGGCATGGTGCACAGTGGTGCTAGTTCGAGAGCAGGGCAGGCACCCCCAGGTCTATCGGGGCTGC
GGGAGCCTGAACCAGGAGCTCTGCCTGGGACGTCCCACGGAGTTTGTGAACCATCACTGCTGCTATAGAT
CCTTCTGCAACCACAATGTGTCCCTGATGCTGGAGGCCACCCAAACTCCTTCGGAGGAGCCAGAAGTAGA
TGCCCATCTGCCTCTGATCCTGGGTCCCGTGCTGGCCTTGCTGGTCCTGGTGGCCCTGGGCACTCTGGGC
TTGTGGCGTGTCCGGAGAAGGCAGGAGAAGCAGCGGGGTCTGCACAGTGACCTGGGCGAGTCCAGTCTCA
TCCTGAAGGCATCGGAACAGGGAGACAGCATGTTGGGGGACTTCCTGGTCAGCGACTGTACCACAGGCAG
CGGCTCAGGGCTACCCTTCTTGGTGCAGAGGACAGTAGCGCGACAGGTTGCACTGGTGGAGTGTGTGGGA
AAGGGCCGATATGGCGAGGTGTGGCGCGGTTCGTGGCATGGCGAGAGTGTGGCGGTCAAGATTTTCTCCT
CACGAGATGAGCAGTCCTGGTTCCGGGAGACAGAGATCTACAACACAGTTCTGCTTAGACACGACAACAT
CCTAGGCTTCATCGCCTCCGACATGACCTCGCGGAACTCCAGCACGCAGCTGTGGCTTATCACCCACTAC
CACGAGCATGGCTCCCTCTATGACTTTCTGCAGAGGCAGACGCTGGAGCCCCAGTTGGCCCTGAGGCTGG
CTGTGTCCGCGGCCTGCGGCCTGGCGCACCTGCATGTAGAGATCTTTGGCACTCAAGGCAAACCAGCCAT
CGCCCATCGTGACCTCAAGAGCCGCAACGTGCTGGTCAAGAGCAACTTGCAGTGTTGCATTGCAGACCTG
GGATTGGCTGTGATGCACTCGCAAAGCAGCGATTACCTGGACATTGGTAACAACCCCCGAGTGGGTACCA
AGAGATACATGGCACCCGAGGTGCTGGATGAGCAGATCCGCACAGACTGTTTTGAGTCGTACAAGTGGAC
AGACATCTGGGCCTTCGGCTTAGTGCTATGGGAGATTGCCCGGCGGACCATCATCAATGGCATTGTGGAG
GACTACAGGCCACCCTTCTATGACATGGTACCCAATGACCCCAGTTTTGAGGACATGAAAAAGGTGGTGT
GTGTTGACCAGCAGACCCCCACCATCCCTAACCGACTGGCAGCAGATCCGGTCCTCTCCGGGCTGGCCCA
GATGATGCGAGAGTGCTGGTACCCCAACCCCTCCGCTCGCCTCACCGCACTGCGCATAAAGAAGACATTA
CAGAAGCTCAGCCAGAATCCAGAGAAACCCAAAGTGATTCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR205137 representing NM_022441
Red=Cloning site Green=Tags(s)

MTLGIFRRVFLMLSVALGLTKGDLVKPSRGQLVNCTCENPHCKRPICQGAWCTVVLVREQGRHPQVYRGC
GSLNQELCLGRPTEFVNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDAHLPLILGPVLALLVLVALGTLG
LWRVRRRQEKQRGLHSDLGESSLILKASEQGDSMLGDFLVSDCTTGSGSGLPFLVQRTVARQVALVECVG
KGRYGEVWRGSWHGESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHY
HEHGSLYDFLQRQTLEPQLALRLAVSAACGLAHLHVEIFGTQGKPAIAHRDLKSRNVLVKSNLQCCIADL
GLAVMHSQSSDYLDIGNNPRVGTKRYMAPEVLDEQIRTDCFESYKWTDIWAFGLVLWEIARRTIINGIVE
DYRPPFYDMVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTL
QKLSQNPEKPKVIH

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_022441
ORF Size 1512 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_022441.1, NM_022441.2, NP_071886
RefSeq Size 3540
RefSeq ORF 1515
Locus ID 25237
Cytogenetics 7q36
MW 57.2 kDa
Gene Summary may play a role in TGF-beta mediated transmembrane signaling in blood vessels [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)