Ifng (NM_138880) Rat Tagged ORF Clone

CAT#: RR205068

  • TrueORF®

Ifng (Myc-DDK-tagged ORF) - Rat interferon gamma (Ifng), (10 ug)

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_138880" in other vectors (3)

Reconstitution Protocol

USD 165.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Mouse Monoclonal Anti-IFN-gamma Antibody
    • 500 ug

USD 608.00

Other products for "Ifng"

Specifications

Product Data
Type Rat Tagged ORF Clone
Tag Myc-DDK
Symbol Ifng
Synonyms IFNG2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RR205068 representing NM_138880
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGCTACACGCCGCGTCTTGGTTTTGCAGCTCTGCCTCATGGCCCTCTCTGGCTGTTACTGCCAAG
GCACACTCATTGAAAGCCTAGAAAGTCTGAAGAACTATTTTAACTCAAGTAGCATGGATGCTATGGAAGG
AAAGAGCCTCCTCTTGGATATCTGGAGGAACTGGCAAAAGGACGGTAACACGAAAATACTTGAGAGCCAG
ATTATCTCTTTCTACCTCAGACTCTTTGAAGTCTTGAAAGACAACCAGGCCATCAGCAACAACATAAGTG
TCATCGAATCGCACCTGATCACTAACTTCTTCAGCAACAGTAAAGCAAAAAAGGATGCATTCATGAGCAT
CGCCAAGTTCGAGGTGAACAACCCACAGATCCAGCACAAAGCTGTCAATGAACTCATCAGAGTGATTCAC
CAGCTGTCACCAGAATCTAGCCTAAGGAAGCGGAAAAGGAGTCGGTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR205068 representing NM_138880
Red=Cloning site Green=Tags(s)

MSATRRVLVLQLCLMALSGCYCQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQ
IISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIH
QLSPESSLRKRKRSRC

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_138880
ORF Size 468 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_138880.2, NP_620235.1
RefSeq Size 525 bp
RefSeq ORF 471 bp
Locus ID 25712
UniProt ID P01581
Cytogenetics 7q22
MW 17.9 kDa
Gene Summary an immune molecule produced by T lymphocytes in response to mitogens or antigens [RGD, Feb 2006]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.