Cacnb4 (NM_001105733) Rat Tagged ORF Clone

CAT#: RR204310

Cacnb4 (Myc-DDK-tagged ORF) - Rat calcium channel, voltage-dependent, beta 4 subunit (Cacnb4), (10 ug)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 618.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cacnb4 (NM_001105733) Rat Tagged ORF Clone
Symbol Cacnb4
Synonyms CAB4; CAB4
Vector pCMV6-Entry
Sequence Data
>RR204310 representing NM_001105733
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTATGACAATTTGTACCTGCATGGAGTTGAAGACTCGGAGGCTGGGTCAGCAGATTCCTATACAAGCA
GGCCATCGGACTCCGATGTCTCTTTGGAAGAGGACCGGGAAGCGATTCGGCAAGAGAGAGAACAGCAAGC
AGCTATCCAGCTTGAGAGAGCGAAGTCCAAACCTGTAGCTTTTGCGGTGAAAACGAATGTGAGCTACTGT
GGTGCCCTGGATGAGGATGTGCCCGTTCCCAGCACAGCCATCTCCTTTGACGCCAAGGACTTTCTTCACA
TTAAAGAGAAATATAACAATGATTGGTGGATAGGAAGGCTGGTGAAGGAGGGCTGTGAGATCGGCTTCAT
CCCAAGTCCACTGCGTTTGGAGAACATACGGATTCAACAGGAACAGAAAAGAGGCCGTTTTCATGGCGGG
AAATCGAGTGGAAACTCTTCCTCCAGTCTGGGAGAAATGGTGTCAGGAACATTTCGAGCAACTCCCACAA
CAACAGCAAAACAGAAGCAGAAAGTGACAGAGCACATTCCTCCGTATGATGTTGTGCCATCAATGCGTCC
TGTGGTGTTAGTGGGGCCATCACTGAAAGGTTATGAGGTAACAGACATGATGCAGAAAGCCCTCTTTGAT
TTCCTGAAGCACAGGTTTGATGGGAGGATATCAATAACCAGAGTGACAGCTGACATTTCTCTTGCTAAGA
GGTCTGTCCTCAACAATCCTAGCAAGAGAGCAATAATTGAACGTTCAAACACCAGATCCAGCCTAGCGGA
AGTACAGAGTGAAATTGAAAGAATTTTCGAGTTGGCAAGATCTTTGCAATTGGTTGTTCTCGATGCAGAC
ACCATCAATCACCCAGCACAGCTGATAAAGACATCGTTAGCGCCCATCATCGTCCACGTGAAGGTCTCGT
CCCCAAAGGTTTTACAGCGGCTGATTAAGTCCAGAGGAAAGTCCCAGAGTAAACACTTGAATGTTCAACT
GGTGGCAGCTGATAAACTGGCCCAGTGTCCCCCTGAAATGTTTGATGTTATATTAGATGAGAATCAACTT
GAGGATGCCTGTGAACATCTGGGAGAGTACCTGGAGGCATATTGGCGTGCCACCCACACAAGCAGTAGCA
CCCCTATGACCCCATTGCTGGGGAGGAACGTGGGCTCCACAGCTCTCTCACCGTATCCCACAGCAATCTC
TGGACTACAGAGTCAGCGGATGAGGCATAGCAACCACTCTACAGAGAATTCTCCAATTGAAAGACGAAGC
CTAATGACCTCTGATGAAAATTACCACAATGAGAGGGCCCGCAAGAGTAGGAACCGCTTGTCCTCCAGCT
CCCAGCACAGCCGAGATCACTACCCTCTGGTGGAAGAAGATTATCCTGACTCATACCAGGACACTTACAA
ACCCCATAGGAACCGAGGCTCACCTGGGGGATGCAGCCATGACTCCCGACATAGGCTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR204310 representing NM_001105733
Red=Cloning site Green=Tags(s)

MYDNLYLHGVEDSEAGSADSYTSRPSDSDVSLEEDREAIRQEREQQAAIQLERAKSKPVAFAVKTNVSYC
GALDEDVPVPSTAISFDAKDFLHIKEKYNNDWWIGRLVKEGCEIGFIPSPLRLENIRIQQEQKRGRFHGG
KSSGNSSSSLGEMVSGTFRATPTTTAKQKQKVTEHIPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFD
FLKHRFDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRSSLAEVQSEIERIFELARSLQLVVLDAD
TINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSRGKSQSKHLNVQLVAADKLAQCPPEMFDVILDENQL
EDACEHLGEYLEAYWRATHTSSSTPMTPLLGRNVGSTALSPYPTAISGLQSQRMRHSNHSTENSPIERRS
LMTSDENYHNERARKSRNRLSSSSQHSRDHYPLVEEDYPDSYQDTYKPHRNRGSPGGCSHDSRHRL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001105733
ORF Size 1458 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001105733.1, NP_001099203
RefSeq Size 3790
RefSeq ORF 1461
Locus ID 58942
Cytogenetics 3q12
MW 55.1 kDa
Gene Summary calcium channel subunit that plays a role in regulating the conductance of L-type voltage gated calcium channels [RGD, Feb 2006].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)