Gja8 (NM_153465) Rat Tagged ORF Clone

CAT#: RR203586

Gja8 (Myc-DDK-tagged ORF) - Rat gap junction membrane channel protein alpha 8 (Gja8), (10 ug)

Change vector?

  • TrueORF®

USD 557


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Gja8 (NM_153465) Rat Tagged ORF Clone
Symbol Gja8
Synonyms Cx50; Cx50
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RR203586 representing NM_153465
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCGACTGGAGTTTCCAGGGAAACATCTTGGAAGAGGTGAATGAACATTCCACCGTCATCGGCAGAG
TTTGGCTCACGGTGCTTTTCATCTTCCGCATCCTCATCCTTGGCACCGCAGCCGAGTTTGTGTGGGGCGA
TGAGCAATCTGATTTTGTATGCAACACCCAGCAGCCAGGTTGTGAGAACGTCTGCTATGATGAGGCCTTT
CCCATCTCGCACATCCGCCTCTGGGTCCTGCAGATCATCTTCGTCTCCACTCCATCGCTGATGTACGTGG
GGCACGCGGTACACCACGTTCGCATGGAGGAGAAGCGAAAGGACCGTGAGGCTGAGGAGCTCTGTCAGCA
GTCTCGCAGCAACGGGGGTGAGAGGGTACCAATCGCCCCAGACCAGGCCAGCATCAGGAAGAGCAGCAGC
AGTAGCAAAGGCACCAAGAAGTTCCGGCTGGAGGGCACACTGCTAAGGACCTATGTCTGCCACATCATCT
TCAAGACCCTCTTTGAGGTGGGCTTCATCGTGGGCCATTACTTCCTGTATGGTTTCCGCATCCTGCCCCT
CTATCGCTGCAGCCGGTGGCCCTGCCCCAATGTGGTGGACTGCTTTGTGTCCCGGCCTACTGAGAAAACC
ATCTTCATCCTCTTCATGTTGTCCGTTGCTTTTGTGTCCCTCTTCCTCAACATCATGGAGATGAGCCACC
TGGGCATGAAGGGAATCCGGTCTGCCTTCAAGAGGCCTGCAGAGCAACCACTGGGGGAGATTGCCGAGAA
GTCCCTCCACTCCATTGCAGTTTCCTCCATCCAGAAAGCCAAGGGCTACCAGCTCCTAGAAGAAGAGAAG
ATCGTTTCACACTATTTCCCTTTGACGGAGGTTGGAATGGTGGAGACCAGCCCCCTGTCAGCCAAGCCTT
TTAGTCAGTTTGAGGAGAAGATCGGCACAGGACCCCTGGCAGATATGTCACGGGGTTACCAAGAAACCCT
GCCTTCTTATGCTCAGGTGGGGGCCCAGGAAGTGGAGCGGGAAGAGCAGCCCGTAGAGGAGGCTGTGGAA
CCGGAATTGGGAGAGAAGAAGCAAGAAGCAGAGAAGGTGGCCCCGGAAGGGCAGGAGACGGTTGCAGTGC
CAGACGGGGAGAAAGTAGAGACCCCTGGGGTAGGGAAGGATGATGAGAAAGAAGAGCTGCAAGCTGAAAA
GGTAACCAAGCAAGGGCTGTCTGCAGAGAAAGCGCCCACACTCTGTCCAGAGCTGACAACCGATGACAAC
CGGCCCTTGAGCAGGCTGAGCAAAGCCAGCAGCAGGGCCAGGTCTGATGATCTCACCATA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RR203586 representing NM_153465
Red=Cloning site Green=Tags(s)

MGDWSFQGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQSDFVCNTQQPGCENVCYDEAF
PISHIRLWVLQIIFVSTPSLMYVGHAVHHVRMEEKRKDREAEELCQQSRSNGGERVPIAPDQASIRKSSS
SSKGTKKFRLEGTLLRTYVCHIIFKTLFEVGFIVGHYFLYGFRILPLYRCSRWPCPNVVDCFVSRPTEKT
IFILFMLSVAFVSLFLNIMEMSHLGMKGIRSAFKRPAEQPLGEIAEKSLHSIAVSSIQKAKGYQLLEEEK
IVSHYFPLTEVGMVETSPLSAKPFSQFEEKIGTGPLADMSRGYQETLPSYAQVGAQEVEREEQPVEEAVE
PELGEKKQEAEKVAPEGQETVAVPDGEKVETPGVGKDDEKEELQAEKVTKQGLSAEKAPTLCPELTTDDN
RPLSRLSKASSRARSDDLTI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_153465
ORF Size 1320 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_153465.1, NM_153465.2, NP_703195
RefSeq Size 1617
RefSeq ORF 1323
Locus ID 29601
Cytogenetics 2q34
MW 49.9 kDa
Gene Summary mutation responsible for the formation of cataracts [RGD, Feb 2006].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations