Aatf (NM_053720) Rat Tagged ORF Clone

CAT#: RR203248

Aatf (Myc-DDK-tagged ORF) - Rat apoptosis antagonizing transcription factor (Aatf), (10 ug)

Change vector?

  • TrueORF®

USD 670


Availability*
4 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Aatf (NM_053720) Rat Tagged ORF Clone
Symbol Aatf
Synonyms Ded; Ded
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RR203248 representing NM_053720
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGAGCTGCAGCCCCTGGCTCTGCAGCTGGAACAGTTGTTGAATCCAAGACCGCGTGAGGCGGATC
CTGAGGCGGACCCGGAGGAGGCCACTAGAGCCAGAGTGATTGACAGGTTTGATGAAGGGGAAGAGGAAGA
AGATGATCTGCCAGTGAGTAGTATTAGAAAGTTGGCACCGGTCTCCCTCTTGGACACCGACAAAAGGTAT
TCTGGCAAGACCACTTCTCGGAAAGCTTGGAAAGAAGACCATTGGGACCAGACTCTGCCAAGTTCATCGG
ACAATGAAATACCTGATGAAGGAGGCTCTGAAGCTGGGGATTCAGAGGGCCTGGAGGAGCTCTCAGAAGA
TGTTGAGGAAGACTTGGAAGACAATGAAATACCTGATGAAGGAGGCTCTGAAGATGGGGATTCAGAGGGC
CTGGAGGAGGAGATCTCAGAAGATGTTGAGGAAGACTTAGAAGGTGAGGATGAGGAAGACAGAGAAGAGG
ACAGGAACAGTGAAGATGACGGCGTGGTGATGGCCTTCTCCGGTGTTAAAGTTTCTGAGGAAGTGGAAAA
AGGAAGAGCTGTGAAGAACCAGATAGCGTTGTGGGACCAGCTCTTGGAAGGAAGGATCAAACTACAAAAA
GCTCTCTTGACTACCAATCAATTGCCTCAACCAGATGTTTTCCCTGTCTTCAAGGACAAAGGTGGCCCAG
AATTTGCCAGTGCTCTGAAAAATAGTCACAAAGCACTTAAAGCATTGTTAAGATCATTGGTGGATCTTCA
GGAAGAGTTGCTTTTCCAGTACCCAGATACAAGATATTTAGTAAAAGGGACGAAACCCAATGCAGAGAGT
GAGGAGATTTCCAGTGAAGATGATGAGCTAGTGGGAGAGAAGAAGAAACAAAGAAAGGCCCCACCAAAGA
GGAAGCTAGAGATGGAGGACTATCCCAGCTTCATGGCAAAGCGCTCTGCTGACTTTACCGTCTACAGGAA
CCGCACACTACAAAAATGGCATGATAAAACCAAGCTTGCTTCTGGAAAACTGGGCAAGGGTTTCGGTGCC
TTTGAACGCTCCATCTTGACTCAGATTGATCATATTCTGATGGACAAAGAAAGATTACTTCGAAGGACGC
AGACCAAGCGCTCTGCCTACCGAGTTCTTGGCAAACCTGAGCCAGTCCCTGAGCCTGTTGCAGAGACTTT
GCCAGGAGAACCGGAGAGCCTTCCTCAGGTCCCTGCCAATGCTCACCTGAAGGACTTGGACGAGGAGATA
TTTGATGATGATGACTTCTACCACCAGCTCCTTCGAGAACTCATAGAGCGGAAGACCAGCTCTTTGGATC
CAAATGATCAGGTGGCCATGGGAAGGCAGTGGCTTGCAATCCAGAAACTACGAAGCAAAATCCGCAAGAA
GGTAGATAGAAAAGCCAGCAAAGGAAGAAAACTTCGGTTCCATGTGCTTAGCAAGCTCCTGAGTTTCATG
GCGCCTATTGACCACACTGCAATGAATGATGAGGCCAGGACCGAGTTGTATCGATCTCTTTTCGGCCAGC
TCAACCGTCTGGACGCAGACCATGGGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RR203248 representing NM_053720
Red=Cloning site Green=Tags(s)

MAELQPLALQLEQLLNPRPREADPEADPEEATRARVIDRFDEGEEEEDDLPVSSIRKLAPVSLLDTDKRY
SGKTTSRKAWKEDHWDQTLPSSSDNEIPDEGGSEAGDSEGLEELSEDVEEDLEDNEIPDEGGSEDGDSEG
LEEEISEDVEEDLEGEDEEDREEDRNSEDDGVVMAFSGVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQK
ALLTTNQLPQPDVFPVFKDKGGPEFASALKNSHKALKALLRSLVDLQEELLFQYPDTRYLVKGTKPNAES
EEISSEDDELVGEKKKQRKAPPKRKLEMEDYPSFMAKRSADFTVYRNRTLQKWHDKTKLASGKLGKGFGA
FERSILTQIDHILMDKERLLRRTQTKRSAYRVLGKPEPVPEPVAETLPGEPESLPQVPANAHLKDLDEEI
FDDDDFYHQLLRELIERKTSSLDPNDQVAMGRQWLAIQKLRSKIRKKVDRKASKGRKLRFHVLSKLLSFM
APIDHTAMNDEARTELYRSLFGQLNRLDADHGQ

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_053720
ORF Size 1569 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_053720.1, NP_446172
RefSeq Size 1805
RefSeq ORF 1572
Locus ID 114512
Cytogenetics 10q26
MW 59.5 kDa
Gene Summary an apoptosis antagonizing nuclear phosphoprotein transcription factor [RGD, Feb 2006].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.