Cdh1 (NM_031334) Rat Tagged ORF Clone

CAT#: RR202985

Reviews ()
Write a review
  • TrueORF®

Cdh1 (Myc-DDK-tagged ORF) - Rat cadherin 1 (Cdh1), (10 ug)



  "NM_031334" in other vectors (3)

Get anti-DDK tag antibody at $68 with code “DDK”. View details.

USD 1,375.00


Availability*
6 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Cdh1 (NM_031334) Rat Tagged ORF Clone
Type Rat Tagged ORF Clone
Tag Myc-DDK
Symbol Cdh1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RR202985 representing NM_031334
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAGCCCGGTGCCGCAGCTTCTCCGCGCTCCTGCTCCTGCTGCAGGTCTCCTCGTGGCTTTGTCAGC
AGCCGGAGTCGGAGTCTGACTCCTGCCGTCCCGGCTTCAGTTCCGAGGTCTACACCTTCCTGGTGCCGGA
GAGGCACCTGGAGAGAGGCCACATCCTGGGCAGAGTGAAATTTGAAGGATGCACCGGCCGTCCAAGGACA
GCCTTCTTTTCTGAAGACTCCCGATTCAAAGTGTCTACAGATGGCGTCATCACAGTCAAACGGCATCTAA
AGCTTCACAAGCTGGAGACCAGTTTTCTCGTCCATGCCTGGGACTCCAGTTACAGGAAGCTTTCTACCAA
AGTGACACTGAAGTCCCTGGGCCACCACCACCACCGGCATCACCACAGAGACCCTGTCTCTGAATCCAAC
CCAGAGCTGCTCACGTTTCCCAGCTTTCACCAGGGTCTGAGAAGACAGAAACGAGACTGGGTCATCCCTC
CCATCAACTGCCCGGAAAATCAAAAGGGCGAATTCCCCCAGCGACTGGTTCAGATCAAATCCAACAGGGA
CAAAGAGACAACGGTTTTCTACAGCATCACCGGCCCAGGAGCTGACAAACCCCCTGTTGGCGTTTTCATC
ATTGAGAGGGAGACAGGCTGGCTGAAAGTGACGCAGCCTCTGGACAGAGAAGCCATTGACAAGTACCTTC
TCTACTCTCATGCTGTGTCATCAAATGGGGAAGCCGTGGAGGATCCCATGGAGATAGTGGTCACAGTCAC
AGATCAGAATGACAACAGGCCAGAGTTTATCCAGGAGGTCTTTGAGGGATCTGTTGCAGAAGGCGCTCTT
CCAGGAACCTCCGTGATGCAGGTCTCAGCCACTGATGCAGACGATGACATAAACACCTACAATGCTGCCA
TCGCCTACACCATCCTCAGCCAAGATCCTGAGCTGCCTCACAAAAACATGTTCACTGTCAACCGGGACAC
TGGGGTCATCAGTGTGGTCACCTCCGGACTGGACCGAGAGAGTTACCCTACATATACTCTGGTGGTTCAG
GCTGCCGACCTTCAAGGCGAAGGCCTAAGCACAACAGCAAAAGCTGTGATCACTGTCAAGGATATTAATG
ACAACGCTCCCATCTTCAACCCAAGCACGTACCAGGGTCAAGTGCTTGAGAATGAGGTCGGTGCCCGTAT
TGCCACACTCAAGGTGACTGATGATGATGCCCCCAACACTCCAGCGTGGAATGCTGTGTACACCGTAGTC
AATGATCCTGATCATCAGTTCACTGTCATCACAGACCCCAAGACCAACGAGGGCATTCTGAAAACAGCCA
AGGGCTTGGATTTTGAGGCCAAGCAGCAGTACATTCTGCACGTGACAGTGGAAAATGAGGAGCCCTTTGA
GGGGTCTCTTGTCCCTTCCACAGCCACTGTCACCGTGGATGTGGTAGACGTGAATGAAGCCCCCATTTTT
GTGCCTGCGGAGAAGAGAGTCGAGGTGCCTGAGGACTTTGGTGTGGGTCTGGAGATCGCATCTTACACTG
CGCGAGAGCCAGACACATTCATGGAACAGAAGATCACGTATCGGATTTGGAGGGACACTGCCAATTGGCT
GGAGATTAACCCAGAGACTGGGGTCATTTCCACTCGGGCTGAGATGGACAGAGAAGATTCGGAGCATGTG
AAGAACAGCACGTATACAGCTCTCATCATTGCCACAGATGATGGTTCACCCATTGCCACTGGCACAGGGA
CTCTTCTCCTGGTCCTGTCAGACGTCAACGACAATGCTCCCATCCCAGAACCTCGAAATATGCAGTTCTG
CCAGAGAAACCCGAAGCCCCATGTCATCACCATCTTGGATCCAGACCTTCCCCCAAACACATCCCCCTTC
ACTGCAGAGCTCACCCATGGGGCCAGCGTCAACTGGACCATTGAGTACAATGACGCAGAACAAGAATCTC
TCATTTTGCAACCAAGAAAGGACTTAGAGATTGGCGAATACAAAATCAATCTCAAGCTCTCGGATAACCA
GAATAAAGACCAGGTGACCACGTTGGAGGTCCACGTGTGTGACTGTGAAGGGACCGTCAACAACTGCATG
AAGGCGATCTCCCTGGAAGCAGGATTACAAGTTCCCGCCATCCTTGGAATCCTGGGAGGGATCCTGGCCC
TCCTGATTCTGATCCTCCTGCTCCTACTGTTTCTACGGAGGAGAACGGTGGTCAAAGAGCCCTTGCTGCC
ACCAGATGACGATACCCGGGACAATGTGTATTACTATGATGAAGAGGGAGGTGGAGAAGAAGACCAGGAC
TTTGATTTGAGCCAGCTGCACAGGGGCCTTGATGCCAGACCGGAAGTGATTCGAAATGATGTGGCTCCCA
CCCTCATGAGCATGCCCCAGTATCGTCCCCGTCCAGCCAATCCTGATGAAATCGGGAACTTCATCGATGA
AAACCTGAAGGCAGCGGACAGTGACCCCACAGCGCCCCCTTACGACTCTCTGTTGGTGTTTGACTATGAG
GGGAGTGGTTCTGAAGCTGCCTCCCTGAGCTCGCTGAACTCCTCTGAGTCAGATCAGGACCAGGACTACG
ATTATCTGAACGAATGGGGCAACCGGTTCAAGAAGCTGGCCGATATGTATGGTGGCGGCGAAGAAGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR202985 representing NM_031334
Red=Cloning site Green=Tags(s)

MGARCRSFSALLLLLQVSSWLCQQPESESDSCRPGFSSEVYTFLVPERHLERGHILGRVKFEGCTGRPRT
AFFSEDSRFKVSTDGVITVKRHLKLHKLETSFLVHAWDSSYRKLSTKVTLKSLGHHHHRHHHRDPVSESN
PELLTFPSFHQGLRRQKRDWVIPPINCPENQKGEFPQRLVQIKSNRDKETTVFYSITGPGADKPPVGVFI
IERETGWLKVTQPLDREAIDKYLLYSHAVSSNGEAVEDPMEIVVTVTDQNDNRPEFIQEVFEGSVAEGAL
PGTSVMQVSATDADDDINTYNAAIAYTILSQDPELPHKNMFTVNRDTGVISVVTSGLDRESYPTYTLVVQ
AADLQGEGLSTTAKAVITVKDINDNAPIFNPSTYQGQVLENEVGARIATLKVTDDDAPNTPAWNAVYTVV
NDPDHQFTVITDPKTNEGILKTAKGLDFEAKQQYILHVTVENEEPFEGSLVPSTATVTVDVVDVNEAPIF
VPAEKRVEVPEDFGVGLEIASYTAREPDTFMEQKITYRIWRDTANWLEINPETGVISTRAEMDREDSEHV
KNSTYTALIIATDDGSPIATGTGTLLLVLSDVNDNAPIPEPRNMQFCQRNPKPHVITILDPDLPPNTSPF
TAELTHGASVNWTIEYNDAEQESLILQPRKDLEIGEYKINLKLSDNQNKDQVTTLEVHVCDCEGTVNNCM
KAISLEAGLQVPAILGILGGILALLILILLLLLFLRRRTVVKEPLLPPDDDTRDNVYYYDEEGGGEEDQD
FDLSQLHRGLDARPEVIRNDVAPTLMSMPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYE
GSGSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEED

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_031334
ORF Size 2658 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_031334.1, NP_112624.1
RefSeq Size 4396 bp
RefSeq ORF 2661 bp
Locus ID 83502
UniProt ID Q9R0T4
Cytogenetics 19q12
MW 98.7 kDa
Gene Summary cell-cell adhesion molecule; may play a role in axonal growth and synase formation [RGD, Feb 2006]

Other Versions

Other products for "Cdh1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools