Dnajc5 (NM_024161) Rat Tagged ORF Clone

CAT#: RR202869

Dnajc5 (Myc-DDK-tagged ORF) - Rat DnaJ (Hsp40) homolog, subfamily C, member 5 (Dnajc5), (10 ug)

Change vector?

  • TrueORF®

USD 402


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Dnajc5 (NM_024161) Rat Tagged ORF Clone
Symbol Dnajc5
Synonyms Csp; Csp
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RR202869 representing NM_024161
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGACCAGAGGCAGCGCTCACTCTCTACTTCCGGGGAATCGTTATACCATGTTCTTGGACTGGACA
AGAATGCAACCTCAGATGACATTAAAAAGTCCTATCGGAAGCTGGCCCTGAAATATCACCCTGACAAGAA
CCCTGATAACCCAGAGGCTGCAGACAAGTTTAAGGAGATTAACAACGCCCACGCAATCCTGACAGACGCC
ACGAAAAGAAACATTTATGACAAGTATGGCTCGCTGGGGCTCTATGTGGCTGAGCAATTTGGGGAGGAGA
ATGTCAACACCTACTTCGTACTCTCCAGCTGGTGGGCCAAGGCGCTGTTCGTCGTCTGTGGCCTCCTCAC
CTGCTGCTACTGCTGCTGCTGTTTATGCTGTTGCTTTAACTGCTGCTGTGGGAAGTGCAAGCCCAAGGCA
CCTGAGGGTGAAGAGACAGAATTCTACGTATCCCCTGAAGACTTGGAGGCACAGCTGCAGTCTGATGAGA
GGGAGGCTACAGACACACCGATCGTCATACAGCCAGCATCCGCCACAGAGACCACCCAGCTGACAGCTGA
CTCCCACCCCAGCTATCACACCGACGGGTTCAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RR202869 representing NM_024161
Red=Cloning site Green=Tags(s)

MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDA
TKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAKALFVVCGLLTCCYCCCCLCCCFNCCCGKCKPKA
PEGEETEFYVSPEDLEAQLQSDEREATDTPIVIQPASATETTQLTADSHPSYHTDGFN

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_024161
ORF Size 594 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_024161.1, NM_024161.2, NP_077075
RefSeq Size 937
RefSeq ORF 597
Locus ID 79130
Cytogenetics 3q43
MW 22.1 kDa
Gene Summary a component of the Hsp90 chaperone complex; involved in synaptic transmission [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations