Abcg1 (NM_053502) Rat Tagged ORF Clone

CAT#: RR202746

Abcg1 (Myc-DDK-tagged ORF) - Rat ATP-binding cassette, sub-family G (WHITE), member 1 (Abcg1), (10 ug)

Change vector?

  • TrueORF®

USD 845


Availability*
4 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Abcg1 (NM_053502) Rat Tagged ORF Clone
Symbol Abcg1
Synonyms Abc8; Abc8
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RR202746 representing NM_053502
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTGTCTGATGGCCGCTTTCTCGGTCGGCACCGCCATGAATGCCAGCAACTACTCGGCCGCAATGA
CGGAACCCAAGTCCGTGTGCGTGTCGGTGGACGAGGTCGTGTCCAGCAACGTGGATGAGCTTGAGACAGA
TCTGCTTAATGGGCACCTGAAGAAGGTGGACAACAACTTCACGGAGGCCCAGCGCTTTTCCTCCCTGCCG
CGGAGGGCGGCCGTGAATATCGAATTCAAGGACCTTTCTTACTCCGTACCCGAGGGACCCTGGTGGAGGA
AGAAAGGATACAAGACCCTTTTGAAAGGGATCTCTGGGAAGTTCAACAGTGGAGAGCTGGTGGCCATCAT
GGGTCCTTCTGGAGCTGGGAAGTCCACACTCATGAATATTCTGGCGGGATACAGGGAGACGGGCATGAAG
GGGGCAGTCCTTATCAATGGTATGCCCCGCGACCTGCGCTGCTTCCGGAAGGTCTCGTGCTACATCATGC
AGGATGACATGCTGCTGCCTCACCTCACTGTCCAGGAGGCCATGATGGTGTCCGCGCATCTGAAGCTGCA
AGAGAGGGATGAAGGCAGACGGGAGATGGTCAAGGAGATCCTGACAGCACTGGGCTTGCTGCCCTGTGCC
AACACACGCACAGGGAGCCTCTCGGGTGGCCAGCGGAAGCGCCTGGCCATTGCACTAGAACTGGTCAACA
ACCCTCCTGTTATGTTCTTTGATGAGCCCACCAGTGGCCTGGACAGTGCCTCTTGCTTCCAAGTGGTGTC
CCTGATGAAAGGGCTGGCCCAGGGCGGCCGCTCCATCGTCTGCACCATCCACCAACCCAGTGCCAAGCTC
TTCGAGCTCTTTGACCAGCTTTATGTCCTAAGTCAAGGACAATGTGTCTACCGGGGAAAGGTCTCGAATC
TCGTGCCGTACCTGAGGGATCTGGGTCTGAACTGCCCTACCTACCACAACCCTGCAGACTTTGTCATGGA
AGTGGCATCAGGGGAGTACGGTGATCAGAACAGCCGCCTGGTGAGGGCCGTTCGGGAGGGCATGTGTGAC
TCTGACTATAAGAGAGAACTCGGGGGCGACGGAGACGTGAACCCGTTCCTCTGGCACCGGCCTGCTGAAG
AGGACTCGGCCTCCATGGAAGGTTGCCACAGCTTCTCGGCCAGCTGCCTCACCCAGTTCTGCATCCTCTT
CAAGAGGACCTTCCTTAGCATCATGCGGGACTCGGTACTGACACACCTGCGAATCACCTCACACATCGGG
ATCGGTCTCCTCATTGGCCTCCTGTACCTTGGGATTGGGAACGAAGCCAAGAAGGTCCTGAGCAACTCCG
GCTTCCTGTTCTTCTCCATGCTGTTCCTCATGTTCGCCGCCCTCATGCCCACCGTTCTGACCTTTCCCCT
CGAGATGAGTGTCTTCCTCCGAGAGCACCTGAACTACTGGTACAGTCTGAAGGCCTACTACCTGGCCAAG
ACCATGGCTGATGTCCCCTTTCAGATCATGTTCCCCGTGGCCTACTGCAGCATCGTGTACTGGATGACAT
CACAGCCGTCGGACGCTGTGCGTTTTGTGCTGTTCGCTGCACTGGGCACCATGACCTCGTTGGTGGCCCA
GTCCTTAGGCCTACTCATTGGAGCTGCGTCCACATCCCTGCAGGTTGCGACGTTTGTGGGTCCCGTGACA
GCCATCCCTGTCTTGCTCTTCTCCGGGTTCTTTGTCAGCTTTGACACCATCCCAACCTACCTGCAGTGGA
TGTCCTACATCTCCTACGTCAGATACGGCTTCGAGGGGGTCATCCTGTCCATCTATGGCTTGGACCGAGA
GGACCTGCACTGCGACATCGCGGAGACATGCCACTTCCAGAAGTCAGAGGCCATCCTGCGGGAGCTAGAT
GTGGAGAACGCGAAGCTATACCTGGATTTCATCGTCCTGGGCATCTTCTTCATCTCCCTGCGGCTCATCG
CCTATTTTGTCCTGAGATACAAAATCCGGGCTGAGAGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RR202746 representing NM_053502
Red=Cloning site Green=Tags(s)

MACLMAAFSVGTAMNASNYSAAMTEPKSVCVSVDEVVSSNVDELETDLLNGHLKKVDNNFTEAQRFSSLP
RRAAVNIEFKDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNILAGYRETGMK
GAVLINGMPRDLRCFRKVSCYIMQDDMLLPHLTVQEAMMVSAHLKLQERDEGRREMVKEILTALGLLPCA
NTRTGSLSGGQRKRLAIALELVNNPPVMFFDEPTSGLDSASCFQVVSLMKGLAQGGRSIVCTIHQPSAKL
FELFDQLYVLSQGQCVYRGKVSNLVPYLRDLGLNCPTYHNPADFVMEVASGEYGDQNSRLVRAVREGMCD
SDYKRELGGDGDVNPFLWHRPAEEDSASMEGCHSFSASCLTQFCILFKRTFLSIMRDSVLTHLRITSHIG
IGLLIGLLYLGIGNEAKKVLSNSGFLFFSMLFLMFAALMPTVLTFPLEMSVFLREHLNYWYSLKAYYLAK
TMADVPFQIMFPVAYCSIVYWMTSQPSDAVRFVLFAALGTMTSLVAQSLGLLIGAASTSLQVATFVGPVT
AIPVLLFSGFFVSFDTIPTYLQWMSYISYVRYGFEGVILSIYGLDREDLHCDIAETCHFQKSEAILRELD
VENAKLYLDFIVLGIFFISLRLIAYFVLRYKIRAER

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_053502
ORF Size 1998 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_053502.1, NP_445954
RefSeq Size 3527
RefSeq ORF 2001
Locus ID 85264
Cytogenetics 20p12
MW 74.1 kDa
Gene Summary ATP-binding cassette (ABC) half-transporter that facilitates the efflux of excess cholesterol from macrophages and may play an important role in cholesterol homeostasis [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.