Kcnt1 (NM_021853) Rat Tagged ORF Clone

CAT#: RR201402

Reviews ()
Write a review
  • TrueORF®

Kcnt1 (Myc-DDK-tagged ORF) - Rat potassium channel, subfamily T, member 1 (Kcnt1), (10 ug)



  "NM_021853" in other vectors (1)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,184.00


Availability*
7 Weeks

Size
    • 10 ug


Product images

Other products for "Kcnt1"

Specifications

Product Data
Type Rat Tagged ORF Clone
Tag Myc-DDK
Symbol Kcnt1
Synonyms rSlo2; Slack
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RR201402 representing NM_021853
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCGGGCCAAGCTGCCGCGCTCACCGTCCGAGGGCAAGGCGGGTCCGGGGGACACCCCAGCCGGCT
CTGCAGCCCCTGAGGAGCCGCACGGACTCAGCCCGCTACTGCCCACCCGCGGCGGGGGCTCCGTGGGCAG
CGACGTGGGCCAGAGGCTTCATGTGGAAGATTTCAGCCTGGACTCTTCCCTTTCTCAGGTCCAGGTGGAA
TTCTATGTCAATGAGAACACCTTCAAAGAACGCCTCAAGCTGTTCTTCATCAAAAACCAGAGATCCAGCC
TGAGGATCCGGCTGTTCAACTTCTCCCTCAAGCTCCTCACCTGCCTGCTGTACATTGTCCGTGTCCTGCT
CGACAACCCAGACCAGGGCATCGGATGCTGGGGCTGCACGAAGTATAACTACACGTTCAATGGTTCGTCC
TCGGAGTTCCACTGGGCTCCCATCCTGTGGGTGGAGAGGAAAATGGCTCTGTGGGTGATCCAGGTCATTG
TGGCCACAATAAGCTTCTTAGAGACCATGCTCCTCATTTACCTCAGCTACAAAGGCAACATCTGGGAGCA
GATATTCCATGTGTCTTTCGTCTTGGAGATGATCAACACACTGCCCTTCATCATCACGGTCTTCTGGCCA
CCTCTCCGGAACCTGTTCATCCCTGTGTTTCTCAACTGCTGGCTGGCCAAGCACGCCCTGGAGAACATGA
TCAATGACTTCCACCGTGCCATCCTGCGCACACAGTCAGCCATGTTCAACCAGGTGCTCATCCTGTTCTG
CACCCTGCTGTGCCTGGTCTTCACAGGGACCTGTGGGATTCAGCACTTAGAGCGGGCAGGTGGCAACTTG
AACTTGCTGACCTCCTTCTACTTCTGCATTGTGACTTTCTCAACCGTGGGCTTCGGTGATGTGACACCCA
AGATCTGGCCATCCCAGCTCCTGGTGGTCATCCTGATCTGTGTCACCCTTGTGGTGCTCCCACTGCAGTT
TGAAGAGCTTGTCTACCTCTGGATGGAGCGGCAGAAGTCAGGGGGCAACTATAGCCGCCACCGAGCACGG
ACAGAGAAGCATGTGGTCCTGTGTGTGAGCTCCCTCAAGATCGATCTCCTCATGGATTTCCTGAATGAGT
TCTATGCCCACCCCCGTCTCCAGGACTACTACGTGGTCATCCTGTGTCCCTCGGAAATGGATGTCCAGGT
GCGCAGGGTCCTACAGATTCCCCTGTGGTCCCAGCGTGTCATCTACCTCCAGGGCTCTGCCCTCAAGGAC
CAGGACCTCATGCGAGCTAAGATGGACAACGGAGAGGCCTGCTTTATCCTCAGCAGCAGGAATGAGGTGG
ACCGCACAGCTGCGGATCACCAGACCATCCTTCGAGCCTGGGCTGTGAAAGACTTTGCCCCCAACTGCCC
CCTCTATGTCCAGATTCTCAAGCCCGAAAACAAGTTTCACGTCAAATTTGCTGACCATGTGGTGTGCGAG
GAAGAGTGCAAGTACGCCATGCTGGCCCTGAACTGCATCTGCCCGGCCACCTCCACCCTCATCACCCTGC
TGGTGCACACATCCCGTGGCCAGGAAGGACAGGAGTCACCAGAGCAGTGGCAGCGCATGTACGGGCGCTG
CTCGGGCAACGAGGTGTACCACATTCGCATGGGTGACAGTAAATTCTTCCGGGAGTATGAGGGCAAGAGC
TTCACCTACGCAGCCTTCCACGCGCACAAGAAGTATGGGGTGTGCCTCATTGGGCTGAAACGTGAAGAGA
ACAAGAGTATCCTGCTGAACCCGGGGCCACGGCACATCCTGGCCGCCTCTGACACCTGCTTCTATATCAA
TATTACCAAGGAGGAGAACTCAGCTTTCATCTTCAAGCAGGAGGAAAAGCAGAATAGGCGGGGCCTGGCA
GGGCAGGCACTTTACGAAGGGCCCTCCCGGCTCCCAGTGCACAGCATCATCGCCTCTATGGTGGCCATGG
ACCTGCAGAACACAGATTGCCGGCCCTCCCAGGGTGGCAGTGGTGGGGGCGGCGGCAAGCTGACTCTGCC
CACTGAGAACGGCTCTGGCAGTCGGCGTCCCAGCATCGCACCCGTTCTGGAGTTGGCAGACAGCTCAGCC
CTGTTGCCCTGCGACCTGCTGAGTGACCAATCAGAGGATGAGGTGACACCCTCAGACGACGAGGGGCTCT
CTGTGGTTGAGTATGTGAAGGGCTACCCTCCCAACTCACCCTACATTGGCAGCTCCCCGACTTTATGCCA
CCTCTTGCCTGTAAAGGCCCCCTTCTGCTGCCTGCGACTGGATAAGGGCTGCAAACACAACAGCTATGAG
GATGCCAAGGCCTACGGGTTCAAGAACAAGTTGATCATCGTCTCTGCTGAGACGGCAGGCAACGGGCTCT
ACAACTTCATCGTGCCTCTGCGTGCCTACTACCGGTCCCGCCGGGAGCTCAACCCCATTGTGCTGCTGCT
TGACAACAAGCCTGACCACCACTTCCTGGAGGCCATCTGCTGCTTCCCCATGGTCTACTACATGGAGGGA
TCCGTGGACAACCTGGACAGCTTGCTGCAGTGTGGCATCATCTATGCTGACAATCTGGTGGTGGTGGACA
AGGAGAGTACCATGAGCGCTGAAGAGGACTACATGGCAGATGCCAAGACCATTGTCAACGTGCAGACCAT
GTTCAGGCTTTTCCCCAGTCTCAGCATCACCACGGAGCTCACGCACCCTTCCAACATGCGGTTCATGCAG
TTCCGGGCCAAGGACAGCTACTCTCTGGCTCTTTCCAAACTTGAAAAGCAAGAACGGGAGAATGGCTCCA
ACCTGGCCTTCATGTTCCGCCTGCCATTTGCTGCTGGTCGGGTGTTTAGTATCAGCATGTTGGATACGCT
GCTCTACCAGTCCTTCGTGAAGGACTACATGATCACCATCACCAGGCTGCTGCTGGGCCTTGACACGACG
CCAGGCTCTGGCTACCTCTGTGCTATGAAGGTAACTGAGGATGACCTGTGGATCCGTACTTATGGCCGCC
TCTTCCAGAAACTCTGCTCCTCCAGCGCTGAGATCCCCATCGGCATCTACAGGACCGAGTGCCATGTCTT
CTCCTCTGAGCCTCATGACCTCAGAGCCCAGTCTCAGATCTCGGTGAACATGGAGGATTGCGAGGACACT
CGGGAGGCCAAGGGGCCCTGGGGCACACGGGCTGCGTCTGGCGGTGGCAGCACCCATGGCCGTCACGGGG
GCAGTGCTGACCCGGTGGAGCACCCACTACTGCGCCGCAAGAGCCTGCAGTGGGCCCGCAAGCTGAGCCG
CAAGAGCAGCAAGCAGGCGGGGAAGGCACCCATGACCACAGACTGGATCACCCAGCAGCGACTCAGCCTG
TACCGGCGCTCAGAGCGCCAGGAGCTCTCGGAGCTGGTCAAGAACCGAATGAAGCACCTGGGGCTGCCCA
CCACTGGCTACGAGGACGTAGCAAATTTAACAGCCAGTGATGTGATGAATCGGGTAAACCTGGGATATTT
GCAAGATGAGATGAATGATCATCACCAGAACACCCTTTCCTATGTACTCATCAACCCCCCGCCAGACACA
AGACTGGAGCCCAACGATATTGTGTACCTCATCCGTTCCGACCCCCTGGCCCACGTGACCAGCAGCTCCC
AGAGTCGGAAAAGCAGCTGCAGCAACAAACTGTCATCCTGTAATCCTGAGACCCGGGATGAGACCCAGCT
CC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR201402 representing NM_021853
Red=Cloning site Green=Tags(s)

MARAKLPRSPSEGKAGPGDTPAGSAAPEEPHGLSPLLPTRGGGSVGSDVGQRLHVEDFSLDSSLSQVQVE
FYVNENTFKERLKLFFIKNQRSSLRIRLFNFSLKLLTCLLYIVRVLLDNPDQGIGCWGCTKYNYTFNGSS
SEFHWAPILWVERKMALWVIQVIVATISFLETMLLIYLSYKGNIWEQIFHVSFVLEMINTLPFIITVFWP
PLRNLFIPVFLNCWLAKHALENMINDFHRAILRTQSAMFNQVLILFCTLLCLVFTGTCGIQHLERAGGNL
NLLTSFYFCIVTFSTVGFGDVTPKIWPSQLLVVILICVTLVVLPLQFEELVYLWMERQKSGGNYSRHRAR
TEKHVVLCVSSLKIDLLMDFLNEFYAHPRLQDYYVVILCPSEMDVQVRRVLQIPLWSQRVIYLQGSALKD
QDLMRAKMDNGEACFILSSRNEVDRTAADHQTILRAWAVKDFAPNCPLYVQILKPENKFHVKFADHVVCE
EECKYAMLALNCICPATSTLITLLVHTSRGQEGQESPEQWQRMYGRCSGNEVYHIRMGDSKFFREYEGKS
FTYAAFHAHKKYGVCLIGLKREENKSILLNPGPRHILAASDTCFYINITKEENSAFIFKQEEKQNRRGLA
GQALYEGPSRLPVHSIIASMVAMDLQNTDCRPSQGGSGGGGGKLTLPTENGSGSRRPSIAPVLELADSSA
LLPCDLLSDQSEDEVTPSDDEGLSVVEYVKGYPPNSPYIGSSPTLCHLLPVKAPFCCLRLDKGCKHNSYE
DAKAYGFKNKLIIVSAETAGNGLYNFIVPLRAYYRSRRELNPIVLLLDNKPDHHFLEAICCFPMVYYMEG
SVDNLDSLLQCGIIYADNLVVVDKESTMSAEEDYMADAKTIVNVQTMFRLFPSLSITTELTHPSNMRFMQ
FRAKDSYSLALSKLEKQERENGSNLAFMFRLPFAAGRVFSISMLDTLLYQSFVKDYMITITRLLLGLDTT
PGSGYLCAMKVTEDDLWIRTYGRLFQKLCSSSAEIPIGIYRTECHVFSSEPHDLRAQSQISVNMEDCEDT
REAKGPWGTRAASGGGSTHGRHGGSADPVEHPLLRRKSLQWARKLSRKSSKQAGKAPMTTDWITQQRLSL
YRRSERQELSELVKNRMKHLGLPTTGYEDVANLTASDVMNRVNLGYLQDEMNDHHQNTLSYVLINPPPDT
RLEPNDIVYLIRSDPLAHVTSSSQSRKSSCSNKLSSCNPETRDETQL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_021853
ORF Size 3711 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_021853.1, NP_068625.1
RefSeq Size 3714 bp
RefSeq ORF 3714 bp
Locus ID 60444
UniProt ID Q9Z258
Cytogenetics 3p13
MW 139.6 kDa
Gene Summary Na(+)-activated potassium channel; may be involved in regulating the firing properties of neurons [RGD, Feb 2006]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.