Tp53 (NM_030989) Rat Tagged ORF Clone

CAT#: RR201296

Tp53 (Myc-DDK-tagged ORF) - Rat tumor protein p53 (Tp53), (10 ug)

Change vector?

  • TrueORF®

USD 402.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Tp53 (NM_030989) Rat Tagged ORF Clone
Symbol Tp53
Synonyms p53; Trp53
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RR201296 representing NM_030989
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGATTCACAGTCGGATATGAGCATCGAGCTCCCTCTGAGTCAGGAGACATTTTCATGCTTATGGA
AACTTCTTCCTCCAGATGATATTCTGCCCACCACAGCGACAGGGTCACCTAATTCCATGGAAGATCTGTT
CCTGCCCCAGGATGTTGCAGAGTTGTTAGAAGGCCCAGAGGAAGCCCTCCAAGTGTCAGCTCCTGCAGCA
CAGGAACCTGGAACTGAGGCCCCTGCACCCGTGGCCCCTGCTTCAGCTACACCGTGGCCTCTGTCATCTT
CCGTCCCTTCTCAAAAAACTTACCAAGGCAACTATGGCTTCCACCTGGGCTTCCTGCAGTCAGGGACAGC
CAAGTCTGTTATGTGCACGTACTCAATTTCCCTCAATAAGCTGTTCTGCCAGCTGGCGAAGACATGCCCT
GTGCAGTTGTGGGTCACCTCCACACCTCCACCTGGTACCCGTGTCCGTGCCATGGCCATCTACAAGAAGT
CACAACACATGACTGAGGTCGTGAGACGCTGCCCCCACCATGAGCGTTGCTCTGATGGTGACGGCCTGGC
TCCTCCCCAACATCTTATCCGGGTGGAAGGAAATCCGTATGCTGAGTATCTGGACGACAGGCAGACTTTT
CGGCACAGCGTGGTGGTACCGTATGAGCCACCTGAGGTCGGCTCCGACTATACCACTATCCACTACAAGT
ACATGTGCAACAGCTCCTGCATGGGGGGCATGAACCGCCGGCCCATCCTTACCATCATCACGCTGGAAGA
CTCCAGTGGGAATCTTCTGGGACGGGACAGCTTTGAGGTTCGTGTTTGTGCCTGTCCTGGGAGAGACCGT
CGGACAGAGGAAGAAAATTTCCGCAAAAAAGAAGAGCATTGCCCGGAGCTGCCCCCAGGGAGTGCAAAGA
GAGCACTGCCCACCAGCACAAGCTCCTCTCCCCAGCAAAAGAAAAAACCACTCGATGGAGAATATTTCAC
CCTTAAGATCCGTGGGCGTGAGCGCTTCGAGATGTTCCGAGAGCTGAATGAGGCCTTGGAATTAAAGGAT
GCCCGTGCTGCCGAGGAGTCAGGAGACAGCAGGGCTCACTCCAGCTACCCGAAGACCAAGAAGGGCCAGT
CTACGTCCCGCCATAAAAAACCAATGATCAAGAAAGTGGGGCCTGACTCAGACCTACGTCCCGCCATAAA
AAACCAATGATCAAGAAAGTGGGGCCTGACTCAGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RR201296 representing NM_030989
Red=Cloning site Green=Tags(s)

MEDSQSDMSIELPLSQETFSCLWKLLPPDDILPTTATGSPNSMEDLFLPQDVAELLEGPEEALQVSAPAA
QEPGTEAPAPVAPASATPWPLSSSVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSISLNKLFCQLAKTCP
VQLWVTSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNPYAEYLDDRQTF
RHSVVVPYEPPEVGSDYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDR
RTEEENFRKKEEHCPELPPGSAKRALPTSTSSSPQQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKD
ARAAEESGDSRAHSSYPKTKKGQSTSRHKKPMIKKVGPDSDLRPAIKNQ*SRKWGLTQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_030989
ORF Size 1226 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_030989.3, NP_112251
RefSeq Size 1792
Locus ID 24842
Cytogenetics 10q24
MW 43.9 kDa
Gene Summary This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it is believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Alternatively spliced transcript variants have been found for this gene, but the biological validity of the variants has not been determined. p53 pseudogenes have been found on chromosomes 9 and 18. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations