Rnps1 (NM_001011890) Rat Tagged ORF Clone

CAT#: RR201287

Rnps1 (Myc-DDK-tagged ORF) - Rat ribonucleic acid binding protein S1 (Rnps1), (10 ug)

Product Images

Circular map for RR201287

Specifications

Product Data

• Type: Rat Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Rnps1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RR201287 representing NM_001011890
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGATTTATCAGGAGTGAAAAAGAAGAGCTTGCTAGGAGTCAAAGAGAATAATAAAAAGTCCAGCACTA
  GGGCTCCTTCTCCTACCAAACGAAAGGACCGCTCTGATGAGAAGTCCAAGGATCGATCTAAAGATAAAGG
  GACCACTAAAGAGTCCAGTGAGAAGGATCGTGGCAGAGATAAGACCCGGAAGAGACGCAGTGCTTCAAGC
  GGAAGCAGCAGCACCAGGTCCAGGTCCAGCTCAACCTCCAGCTCGGGCTCCAGCACCAGCACGGGCTCGA
  GCAGTGGCTCTAGCTCGTCTTCTGCGTCCAGCCGCTCAGGAAGCTCCAGCACATCCCGGAGCTCCAGTTC
  CAGCAGCTCCTCCGGCTCCCCAAGCCCTTCTCGGCGCAGACATGACAACAGGCGGCGTTCCCGCTCCAAA
  TCCAAACCACCTAAAAGAGATGAAAAAGAGAGGAAAAGGCGGAGCCCTTCACCTAAACCCACCAAAGTGC
  ACATTGGGAGGCTCACCAGGAATGTGACCAAGGATCATATCATGGAAATATTTTCTACTTACGGGAAAAT
  TAAAATGATTGACATGCCTGTGGAAAGGATGCATCCTCATCTATCCAAAGGCTATGCGTACGTGGAATTC
  GAGAATCCGGATGAAGCAGAGAAGGCACTGAAACACATGGATGGAGGACAAATAGATGGCCAAGAGATCA
  CTGCTACTGCGGTGTTGGCACCCTGGCCTCGTCCACCGCCTCGGCGATTCAGCCCACCCAGGAGAATGCT
  TCCACCGCCTCCCATGTGGCGTAGGTCACCCCCACGGATGAGGAGAAGGTCTCGATCCCCAAGACGCAGG
  TCCCCTGTGCGAAGGAGGTCTCGATCGCCTGGCCGCCGCCGCCACAGGAGCCGATCCAGCTCCAACTCCT
  CCCGA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RR201287 representing NM_001011890
  Red=Cloning site Green=Tags(s)
  
  MDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRSDEKSKDRSKDKGTTKESSEKDRGRDKTRKRRSASS
  GSSSTRSRSSSTSSSGSSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSSSSGSPSPSRRRHDNRRRSRSK
  SKPPKRDEKERKRRSPSPKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEF
  ENPDEAEKALKHMDGGQIDGQEITATAVLAPWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRR
  SPVRRRSRSPGRRRHRSRSSSNSSR
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001011890
• ORF Size: 915 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001011890.1, NP_001011890.1
• RefSeq Size: 1853 bp
• RefSeq ORF: 918 bp
• Locus ID: 287113
• UniProt ID: Q6AYK1
• Cytogenetics: 10q12
• MW: 34.2 kDa
• Gene Summary: Part of pre- and post-splicing multiprotein mRNP complexes. Auxiliary component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Component of the ASAP and PSAP complexes which bind RNA in a sequence-independent manner and are proposed to be recruited to the EJC prior to or during the splicing process and to regulate specific excision of introns in specific transcription subsets. The ASAP complex can inhibit RNA processing during in vitro splicing reactions. The ASAP complex promotes apoptosis and is disassembled after induction of apoptosis. Enhances the formation of the ATP-dependent A complex of the spliceosome. Involved in both constitutive splicing and, in association with SRP54 and TRA2B/SFRS10, in distinctive modulation of alternative splicing in a substrate-dependent manner. Involved in the splicing modulation of BCL2L1/Bcl-X (and probably other apoptotic genes); specifically inhibits formation of proapoptotic isoforms such as Bcl-X(S); the activity is different from the established EJC assembly and function. Participates in mRNA 3'-end cleavage. Involved in UPF2-dependent nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Also mediates increase of mRNA abundance and translational efficiency. Binds spliced mRNA 20-25 nt upstream of exon-exon junctions (By similarity).[UniProtKB/Swiss-Prot Function]