Gfra3 (NM_053398) Rat Tagged ORF Clone

CAT#: RR200905

Gfra3 (Myc-DDK-tagged ORF) - Rat GDNF family receptor alpha 3 (Gfra3), (10 ug)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 402.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Gfra3 (NM_053398) Rat Tagged ORF Clone
Symbol Gfra3
Vector pCMV6-Entry
Sequence Data
>RR200905 representing NM_053398
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCTCTCCCGGAGCCCGCGACCGCCGCCGCTAGTGATCCTGCTACTGGTGCTGTCGCTGTGGCTAC
CCCTTGGAACAGGAAACTCCCTTCCCACAGAGAACAGGCTTGTGAACAGCTGTACCCAGGCCAGAAAAAA
ATGCGAGGCTAATCCCGCTTGCAAGGCTGCCTACCAGCACCTGGACTCCTGCACCCCCAGTCTCAGCAGT
CCACTGCCCTCAGGGGAGTCTGCCACATCTGCAGCGTGCCTTGAAGCAGCACAGCAACTCAGGAACAGCT
CTCTCATAGACTGCAGGTGCCACCGGCGCATGAAGCACCAAGCTACCTGTCTGGACATTTATTGGACCGT
TCACCCTGTCCGAAGCCTTGGTGACTACGAGTTGGACGTCTCACCCTATGAAGACACAGTGACCAGCAAA
CCCTGGAAAATGAATCTCAGCAAGCTGAGCATGCTCAAACCAGACTCCGACCTCTGCCTCAAATTTGCTA
TGCTGTGTACTCTTAACGACAAGTGCGACCGCCTCCGAAAGGCCTACGGGGAGGCGTGCTCAGGGATCCG
CTGCCAGCGCCACCTCTGCCTAGCTCAGCTGCGCTCCTTCTTCGAGAAGGCGGCAGAGTCCCACGCTCAG
GGCCTGCTGCTGTGTCCCTGTGCACCCGAAGATGCGGGCTGTGGGGAGCGCCGGCGCAACACCATCGCCC
CCAGTTGCGCCCTCCCGTCTGTGGCCCCCAACTGCCTAGATCTTCGGAGCTTCTGCCGTGCGGACCCTCT
GTGCAGATCACGCCTGATGGACTTCCAGACCCACTGCCACCCTATGGACATCCTCGGGACTTGTGCAACT
GAGCAGTCCAGATGTCTGCGGGCATACCTGGGGCTAATTGGGACTGCCATGACCCCAAACTTCATCAGCA
AGGTCAACACTACTGTTGCCTTAGGCTGTACCTGCCGAGGCAGTGGCAACCTGCAGGACGAGTGTGAACA
GCTGGAAAAGTCCTTCTCCCAGAACCCCTGCCTCATGGAGGCCATTGCGGCTAAAATGCGTTTCCACAGA
CAACTCTTCTCCCAGGACTGGGCGGACTCTACTTTTTCTGTGATGCAGCAGCAGAACAGCAGCCCTGCTC
TGAGGCCCCAGCTCAGGCTACCCGTTCTGTCTTTCTTCATCCTTACCTTGATTCTGCTGCAGACCCTCTG
GG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR200905 representing NM_053398
Red=Cloning site Green=Tags(s)

MGLSRSPRPPPLVILLLVLSLWLPLGTGNSLPTENRLVNSCTQARKKCEANPACKAAYQHLDSCTPSLSS
PLPSGESATSAACLEAAQQLRNSSLIDCRCHRRMKHQATCLDIYWTVHPVRSLGDYELDVSPYEDTVTSK
PWKMNLSKLSMLKPDSDLCLKFAMLCTLNDKCDRLRKAYGEACSGIRCQRHLCLAQLRSFFEKAAESHAQ
GLLLCPCAPEDAGCGERRRNTIAPSCALPSVAPNCLDLRSFCRADPLCRSRLMDFQTHCHPMDILGTCAT
EQSRCLRAYLGLIGTAMTPNFISKVNTTVALGCTCRGSGNLQDECEQLEKSFSQNPCLMEAIAAKMRFHR
QLFSQDWADSTFSVMQQQNSSPALRPQLRLPVLSFFILTLILLQTLW

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_053398
ORF Size 1192 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_053398.1, NP_445850
RefSeq Size 2070
RefSeq ORF 1194
Locus ID 84422
Cytogenetics 18p12
MW 44.5 kDa
Gene Summary responsible for neuronal cell protection and cell survival in the inner ear [RGD, Feb 2006].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)