Aldoc (NM_012497) Rat Tagged ORF Clone

CAT#: RR200828

Aldoc (Myc-DDK-tagged ORF) - Rat aldolase C, fructose-bisphosphate (Aldoc), (10 ug)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 402.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name Aldoc (NM_012497) Rat Tagged ORF Clone
Symbol Aldoc
Synonyms ALDCAA; F16dip7; RATALDCAA
Vector pCMV6-Entry
Sequence Data
>RR200828 representing NM_012497
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCCACTCATACCCAGCCCTTTCTGCTGAGCAGAAGAAGGAGTTGTCGGATATTGCTCTGAGGATTG
TGGCCCCAGGCAAGGGCATTCTGGCTGCAGATGAGTCCGTGGGCAGCATGGCCAAAAGGCTGAGCCAAAT
TGGGGTAGAGAACACTGAGGAGAATCGCCGACTGTACCGCCAGGTCCTGTTCAGTGCTGATGACCGTGTG
AAAAAGTGCATTGGGGGGGTCATCTTCTTCCACGAGACACTCTACCAGAAAGATGACAATGGTGTCCCCT
TTGTCCGCACCATCCAGGAGAAGGGCATTCTCGTAGGCATCAAGGTTGACAAGGGTGTAGTGCCTCTAGC
TGGGACTGATGGAGAAACCACCACTCAAGGGCTGGATGGACTCTTGGAACGCTGTGCTCAGTATAAGAAG
GACGGTGCTGATTTTGCCAAATGGCGCTGTGTGCTGAAAATCAGTGATCGCACACCCTCGGCACTGGCCA
TACTGGAGAATGCCAATGTGCTGGCCCGCTATGCCAGCATCTGCCAGCAGAATGGTATCGTGCCCATCGT
GGAGCCTGAGATCCTGCCTGATGGAGACCATGACCTCAAACGTTGCCAGTTTGTTACAGAGAAGGTCCTG
GCTGCTGTGTACAAGGCCTTGAGTGATCATCACGTATACCTGGAAGGGACTCTCCTCAAGCCCAACATGG
TGACCCCTGGCCATGCCTGTCCCATCAAATATAGCCCAGAAGAGATCGCCATGGCAACTGTCACTGCCCT
GCGTCGAACTGTGCCCCCAGCTGTCCCAGGGGTGACTTTCCTGTCTGGGGGTCAGAGTGAAGAGGAGGCA
TCACTCAACCTCAATGCCATCAACCGATGCTCACTTCCCCGGCCCTGGGCCCTCACCTTCTCCTACGGAC
GTGCCCTGCAGGCATCTGCACTCAGTGCCTGGAGAGGACAAAGGGATAATGCTGGGGCTGCTACTGAGGA
GTTTATCAAGCGGGCCGAGATGAACGGGCTTGCAGCCCAGGGCAAATATGAAGGCAGTGGAGATGGTGGA
GCAGCAGCACAGTCCCTCTACGTGGCCAACCATGCCTACGCAGCAGCACAGTCCCTCTACGTGGCCAACC
ATGCCTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR200828 representing NM_012497
Red=Cloning site Green=Tags(s)

MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRV
KKCIGGVIFFHETLYQKDDNGVPFVRTIQEKGILVGIKVDKGVVPLAGTDGETTTQGLDGLLERCAQYKK
DGADFAKWRCVLKISDRTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQFVTEKVL
AAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYSPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEA
SLNLNAINRCSLPRPWALTFSYGRALQASALSAWRGQRDNAGAATEEFIKRAEMNGLAAQGKYEGSGDGG
AAAQSLYVANHAYAAAQSLYVANHAY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_012497
ORF Size 1128 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_012497.1, NP_036629
RefSeq Size 1581
RefSeq ORF 1092
Locus ID 24191
Cytogenetics 10q25
MW 39.7 kDa
Gene Summary brain-specific member of the aldolase enzyme family; may play a role in neurogenesis [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)