OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Apc11 (ANAPC11) (NM_001289416) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG235521
ANAPC11 (tGFP-tagged) - Human anaphase promoting complex subunit 11 (ANAPC11), transcript variant 10
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $350.00
2 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA506325 ANAPC11 (Apc11) mouse monoclonal antibody, clone OTI3C4 (formerly 3C4) 100 ul
$447.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Apc11 or NM_001289416"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Apc11
Synonyms APC11; Apc11p; HSPC214
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG235521 representing NM_001289416.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGAAGGTGAAGATTAAGTGCTGGAACGGCGTGGCCACTTGGCTCTGGGTGGCCAACGATGAGAACTGTG
GCATCTGCAGGATGGCATTTAACGGATGCTGCCCTGACTGCAAGGTGCCCGGCGACGACTGCCCGCTGGT
GTGGGGCCAGTGCTCCCACTGCTTCCACATGCATTGCATCCTCAAGTGGCTGCACGCACAGCAGGTGCAG
CAGCACTGCCCCATGTGCCGCCAGGAATGGAAGTTCAAGGAG
ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAAAC
Protein Sequence
>RG235521 representing NM_001289416
Red=Cloning site Green=Tags(s)

MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQ
QHCPMCRQEWKFKE

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001289416
ORF Size 252 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001289416.1, NP_001276345.1
RefSeq Size 914 bp
RefSeq ORF 255 bp
Locus ID 51529
UniProt ID Q9NYG5
Cytogenetics 17q25.3
Protein Families Druggable Genome
Protein Pathways Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis
MW 9.8 kDa
Summary Together with the cullin protein ANAPC2, constitutes the catalytic component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. May recruit the E2 ubiquitin-conjugating enzymes to the complex.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001289416" in other vectors (2)
SKU Description Size Price
RC235521 ANAPC11 (myc-DDK-tagged) - Human anaphase promoting complex subunit 11 (ANAPC11), transcript variant 10 10 ug
$289.00
SC333415 ANAPC11 (untagged) - Human anaphase promoting complex subunit 11 (ANAPC11), transcript variant 10 10 ug
$165.00

Plasmid Map for RG235521

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG235521
Circular map for RG235521

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products