ERBIN (NM_001253697) Human Tagged ORF Clone

CAT#: RG235298

ERBB2IP (GFP-tagged) - Homo sapiens erbb2 interacting protein (ERBB2IP), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,484.00


Availability*
13 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ERBIN (NM_001253697) Human Tagged ORF Clone
Symbol ERBIN
Synonyms ERBB2IP; HEL-S-78; LAP2
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG235298 representing NM_001253697
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTACAAAACGAAGTTTGTTTGTGCGGTTGGTACCATGTCGCTGTCTACGAGGGGAAGAGGAGACTG
TCACTACTCTTGATTATTCTCATTGCAGCTTAGAACAAGTTCCGAAAGAGATTTTTACTTTTGAAAAAAC
CTTGGAGGAACTCTATTTAGATGCTAATCAGATTGAAGAGCTTCCAAAGCAACTTTTTAACTGTCAGTCT
TTACACAAACTGAGTTTGCCAGACAATGATTTAACAACGTTACCAGCATCCATTGCAAACCTTATTAATC
TCAGGGAACTGGATGTCAGCAAGAATGGAATACAGGAGTTTCCAGAAAATATAAAAAATTGTAAAGTTTT
GACAATTGTGGAGGCCAGTGTAAACCCTATTTCCAAGCTCCCTGATGGATTTTCTCAGCTGTTAAACCTA
ACCCAGTTGTATCTGAATGATGCTTTTCTTGAGTTCTTGCCAGCAAATTTTGGCAGATTAACTAAACTCC
AAATATTAGAGCTTAGAGAAAACCAGTTAAAAATGTTGCCTAAAACTATGAATAGACTGACCCAGCTGGA
AAGACTGGATTTGGGAAGTAACGAATTCACGGAAGTGCCTGAAGTACTTGAGCAACTAAGTGGATTGAAA
GAGTTTTGGATGGATGCTAATAGACTGACTTTTATTCCAGGGTTTATTGGTAGTTTGAAACAGCTCACAT
ATTTGGATGTTTCTAAAAATAATATTGAAATGGTTGAAGAAGGAATTTCAACATGTGAAAACCTTCAAGA
CCTCCTATTATCAAGCAATTCACTTCAGCAGCTTCCTGAGACTATTGGTTCGTTGAAGAATATAACAACG
CTTAAAATAGATGAAAACCAGTTAATGTATCTGCCAGACTCTATAGGAGGGTTAATATCAGTAGAAGAAC
TGGATTGTAGTTTCAATGAAGTTGAAGCTTTGCCTTCATCTATTGGGCAGCTTACTAACTTAAGAACTTT
TGCTGCTGATCATAATTACTTACAGCAGTTGCCCCCAGAGATTGGAAGCTGGAAAAATATAACTGTGCTG
TTTCTCCATTCCAATAAACTTGAGACACTTCCAGAGGAAATGGGTGATATGCAAAAATTAAAAGTCATTA
ATTTAAGTGATAATAGATTAAAGAATTTACCCTTTAGCTTTACAAAGCTACAGCAATTGACAGCTATGTG
GCTCTCAGATAATCAGTCCAAACCCCTGATACCTCTTCAAAAAGAAACTGATTCAGAGACCCAGAAAATG
GTGCTTACCAACTACATGTTCCCTCAACAGCCAAGGACTGAGGATGTTATGTTTATATCAGATAATGAAA
GTTTTAACCCTTCATTGTGGGAGGAACAGAGGAAACAGCGGGCTCAAGTTGCATTTGAATGTGATGAAGA
CAAAGATGAAAGGGAGGCACCTCCCAGGGAGGGAAATTTAAAAAGATATCCAACACCATACCCAGATGAG
CTTAAGAATATGGTCAAAACTGTTCAAACCATTGTACATAGATTAAAAGATGAAGAGACCAATGAAGACT
CAGGAAGAGATTTGAAACCACATGAAGATCAACAAGATATAAATAAAGATGTGGGTGTGAAGACCTCAGA
AAGTACTACTACAGTAAAAAGCAAAGTTGATGAAAGAGAAAAATATATGATAGGAAACTCTGTACAGAAG
ATCAGTGAACCTGAAGCTGAGATTAGTCCTGGGAGTTTACCAGTGACTGCAAATATGAAAGCCTCTGAGA
ACTTGAAGCATATTGTTAACCATGATGATGTTTTTGAGGAATCTGAAGAACTTTCTTCTGATGAAGAGAT
GAAAATGGCGGAGATGCGACCACCATTAATTGAAACCTCTATTAACCAGCCAAAAGTCGTAGCACTTAGT
AATAACAAAAAAGATGATACAAAGGAAACAGATTCTTTATCAGATGAAGTTACACACAATAGCAATCAGA
ATAACAGCAATTGTTCTTCTCCATCTCGGATGTCTGATTCAGTTTCTCTTAATACTGATAGTAGTCAAGA
CACCTCACTCTGCTCTCCAGTGAAACAAACTCATATTGATATTAATTCCAAAATCAGGCAAGAAGATGAA
AATTTTAACAGCCTTTTACAAAATGGAGATATTTTAAACAGTTCAACAGAGGAAAAGTTCAAAGCTCATG
ATAAAAAAGATTTTAACTTACCTGAATATGATTTGAATGTTGAAGAGCGATTAGTTCTAATTGAGAAAAG
TGTTGACTCAACAGCCACAGCTGATGACACTCACAAATTAGATCATATCAATATGAATCTTAATAAACTT
ATAACTAATGATACATTTCAACCAGAGATCATGGAAAGATCAAAAACACAGGATATTGTGCTTGGAACAA
GCTTTTTAAGCATTAATTCTAAAGAGGAAACTGAGCACTTGGAAAATGGAAACAAGTATCCTAATTTGGA
ATCCGTAAATAAGGTAAATGGACATTCTGAGGAAACTTCCCAGTCTCCTAATAGGACTGAACCACATGAC
AGTGATTGTTCTGTTGACTTAGGTATTTCCAAAAGCACTGAAGATCTCTCCCCTCAGAAAAGTGGTCCAG
TTGGATCTGTTGTGAAATCTCATAGCATAACTAATATGGAGATTGGAGGGCTAAAAATCTATGATATTCT
TAGTGATAATGGACCTCAGCAGCCAAGTACAACCGTTAAAATCACATCTGCTGTTGATGGAAAAAATATA
GTCAGGAGCAAGTCTGCCACACTGTTGTATGATCAACCATTGCAGGTATTTACTGGTTCTTCCTCATCTT
CTGATTTAATATCAGGAACAAAGGCAATTTTCAAGTTTGATTCAAATCATAATCCCGAAGAGCCAAATAT
AATAAGAGGCCCCACAAGTGGCCCACAATCTGCACCTCAAATATATGGTCCTCCACAGTATAATATCCAA
TACAGTAGCAGTGCTGCAGTCAAAGACACTTTGTGGCACTCCAAACAAAATCCCCAAATAGACCATGCCA
GTTTTCCTCCTCAGCTCCTTCCTAGATCAGAGAGCACAGAAAATCAAAGTTATGCTAAACATTCTGCCAA
TATGAATTTCTCTAATCATAACAATGTTCGAGCTAATACTGCATACCATTTACATCAGAGACTTGGCCCA
GCAAGACATGGGGAAATGTGGGCCATCTCACCAAACGACCGACTTATTCCTGCAGTAACTCGAAGTACAA
TCCAGCGACAAAGTAGTGTGTCCTCCACAGCCTCTGTAAATCTTGGTGATCCAGGCTCTACAAGGCGGGC
TCAGATTCCTGAAGGAGATTATTTATCATACAGAGAGTTCCACTCAGCGGGAAGAACTCCTCCAATGATG
CCAGGATCACAGAGACCCCTTTCTGCACGAACATACAGCATAGATGGTCCAAATGCATCAAGACCTCAGA
GTGCTCGACCCTCTATTAATGAAATACCAGAGAGAACTATGTCAGTTAGTGATTTCAATTATTCACGGAC
TAGTCCTTCAAAAAGACCAAATGCAAGGGTTGGTTCTGAGCATTCTTTATTAGATCCTCCAGGAAAAAGT
AAAGTTCCTCGTGACTGGAGAGAACAAGTACTTCGACATATTGAAGCCAAAAAGTTAGAAAAGAAGCATC
CCCAGACATCCAGTTCAGGAGATCCTTGTCAAGATGGTATATTCATTTCAGGACAGCAGAACTACTCATC
AGCCACACTTAGTCACAAAGATGTTCCTCCAGACAGCTTGATGAAAATGCCTTTGAGTAATGGACAGATG
GGCCAGCCTCTCAGGCCTCAGGCAAATTATAGTCAAATACATCACCCCCCTCAGGCATCTGTGGCAAGGC
ATCCCTCTAGAGAACAACTAATTGATTACTTGATGCTGAAAGTGGCCCACCAGCCTCCATATACACAGCC
CCATTGTTCTCCTAGACAAGGCCATGAACTGGCAAAACAAGAGATTCGAGTGAGGGTTGAAAAGGATCCA
GAACTTGGATTTAGCATATCAGGTGGTGTCGGGGGTAGAGGAAACCCATTCAGACCTGATGATGATGGTA
TATTTGTAACAAGGGTACAACCTGAAGGACCAGCATCAAAATTACTGCAGCCAGGTGATAAAATTATTCA
GGCTAATGGCTACAGTTTTATAAATATTGAACATGGACAAGCAGTGTCCTTGCTAAAAACTTTCCAGAAT
ACAGTTGAACTCATCATTGTACGAGAAGTTTCCTCA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG235298 representing NM_001253697
Red=Cloning site Green=Tags(s)

MTTKRSLFVRLVPCRCLRGEEETVTTLDYSHCSLEQVPKEIFTFEKTLEELYLDANQIEELPKQLFNCQS
LHKLSLPDNDLTTLPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNL
TQLYLNDAFLEFLPANFGRLTKLQILELRENQLKMLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLK
EFWMDANRLTFIPGFIGSLKQLTYLDVSKNNIEMVEEGISTCENLQDLLLSSNSLQQLPETIGSLKNITT
LKIDENQLMYLPDSIGGLISVEELDCSFNEVEALPSSIGQLTNLRTFAADHNYLQQLPPEIGSWKNITVL
FLHSNKLETLPEEMGDMQKLKVINLSDNRLKNLPFSFTKLQQLTAMWLSDNQSKPLIPLQKETDSETQKM
VLTNYMFPQQPRTEDVMFISDNESFNPSLWEEQRKQRAQVAFECDEDKDEREAPPREGNLKRYPTPYPDE
LKNMVKTVQTIVHRLKDEETNEDSGRDLKPHEDQQDINKDVGVKTSESTTTVKSKVDEREKYMIGNSVQK
ISEPEAEISPGSLPVTANMKASENLKHIVNHDDVFEESEELSSDEEMKMAEMRPPLIETSINQPKVVALS
NNKKDDTKETDSLSDEVTHNSNQNNSNCSSPSRMSDSVSLNTDSSQDTSLCSPVKQTHIDINSKIRQEDE
NFNSLLQNGDILNSSTEEKFKAHDKKDFNLPEYDLNVEERLVLIEKSVDSTATADDTHKLDHINMNLNKL
ITNDTFQPEIMERSKTQDIVLGTSFLSINSKEETEHLENGNKYPNLESVNKVNGHSEETSQSPNRTEPHD
SDCSVDLGISKSTEDLSPQKSGPVGSVVKSHSITNMEIGGLKIYDILSDNGPQQPSTTVKITSAVDGKNI
VRSKSATLLYDQPLQVFTGSSSSSDLISGTKAIFKFDSNHNPEEPNIIRGPTSGPQSAPQIYGPPQYNIQ
YSSSAAVKDTLWHSKQNPQIDHASFPPQLLPRSESTENQSYAKHSANMNFSNHNNVRANTAYHLHQRLGP
ARHGEMWAISPNDRLIPAVTRSTIQRQSSVSSTASVNLGDPGSTRRAQIPEGDYLSYREFHSAGRTPPMM
PGSQRPLSARTYSIDGPNASRPQSARPSINEIPERTMSVSDFNYSRTSPSKRPNARVGSEHSLLDPPGKS
KVPRDWREQVLRHIEAKKLEKKHPQTSSSGDPCQDGIFISGQQNYSSATLSHKDVPPDSLMKMPLSNGQM
GQPLRPQANYSQIHHPPQASVARHPSREQLIDYLMLKVAHQPPYTQPHCSPRQGHELAKQEIRVRVEKDP
ELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQN
TVELIIVREVSS

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001253697
ORF Size 4236 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001253697.1, NP_001240626
RefSeq Size 7042
RefSeq ORF 4239
Locus ID 55914
Cytogenetics 5q12.3
Protein Families Druggable Genome
Protein Pathways NOD-like receptor signaling pathway
Gene Summary This gene is a member of the leucine-rich repeat and PDZ domain (LAP) family. The encoded protein contains 17 leucine-rich repeats and one PDZ domain. It binds to the unphosphorylated form of the ERBB2 protein and regulates ERBB2 function and localization. It has also been shown to affect the Ras signaling pathway by disrupting Ras-Raf interaction. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)