FOXO4(FOXO4) (NM_001170931) Human Tagged ORF Clone

CAT#: RG230105

FOXO4 (GFP-tagged) - Human forkhead box O4 (FOXO4), transcript variant 2

Change vector?

  • TrueORF®

USD 629.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FOXO4(FOXO4) (NM_001170931) Human Tagged ORF Clone
Symbol FOXO4
Synonyms AFX; AFX1; MLLT7
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG230105 representing NM_001170931
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATCCGGGGAATGAGAATTCAGCCACAGAGGCTGCCGCGATCATAGACCTAGATCCCGACTTCGAAC
CCCAGAGCCGTCCCCGCTCCTGCACCTGGCCCCTTCCCCGACCAGAGATCGCTAACCAGCCGTCCGAGCC
GCCCGAGGTGGAGCCAGATCTGGGGGAAAAGGCCATTGAAAGCGCCCCGGAGAAGCGACTGACACTTGCC
CAGATCTACGAGTGGATGGTCCGTACTGTACCCTACTTCAAGGACAAGGGTGACAGCAACAGCTCAGCAG
GATGGAAGAACTCGATCCGCCACAACCTGTCCCTGCACAGCAAGTTCATCAAGGTTCACAACGAGGCCAC
CGGCAAAAGCTCTTGGTGGATGCTGAACCCTGAGGGAGGCAAGAGCGGCAAAGCCCCCCGCCGCCGGGCC
GCCTCCATGGATAGCAGCAGCAAGCTGCTCCGGGGCCGCAGTAAAGCCCCCAAGAAGAAACCATCTGTGC
TGCCAGCTCCACCCGAAGGTGCCACTCCAACGAGCCCTGTCGGCCACTTTGCCAAGTGGTCAGGCAGCCC
TTGCTCTCGAAACCGTGAAGAAGCCGATATGTGGACCACCTTCCGTCCACGAAGCAGTTCAAATGCCAGC
AGTGTCAGCACCCGGCTGTCCCCCTTGAGGCCAGAGTCTGAGGTGCTGGCGGAGGAAATACCAGCTTCAG
TCAGCAGTTATGCAGGGGGTGTCCCTCCCACCCTCAATGAAGGTCTAGAGCTGTTAGATGGGCTCAATCT
CACCTCTTCCCATTCCCTGCTATCTCGGAGTGGTCTCTCTGGCTTCTCTTTGCAGCATCCTGGGGTTACC
GGCCCCTTACACACCTACAGCAGCTCCCTTTTCAGCCCAGCAGAGGGGCCCCTGTCAGCAGGAGAAGGGT
GCTTCTCCAGCTCCCAGGCTCTGGAGGCCCTGCTCACCTCTGATACGCCACCACCCCCTGCTGACGTCCT
CATGACCCAGGTAGATCCCATTCTGTCCCAGGCTCCGACTCTTCTGTTGCTGGGGGGGCTTCCTTCCTCC
AGTAAGCTGGCCACGGGCGTCGGCCTGTGTCCCAAGCCCCTAGAGGCTCCAGGCCCCAGCAGTCTGGTTC
CCACCCTTTCTATGATAGCACCACCTCCAGTCATGGCAAGTGCCCCCATCCCCAAGGCTCTGGGGACTCC
TGTGCTCACACCCCCTACTGAAGCTGCAAGCCAAGACAGAATGCCTCAGGATCTAGATCTTGATATGTAT
ATGGAGAACCTGGAGTGTGACATGGATAACATCATCAGTGACCTCATGGATGAGGGCGAGGGACTGGACT
TCAACTTTGAGCCAGATCCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG230105 representing NM_001170931
Red=Cloning site Green=Tags(s)

MDPGNENSATEAAAIIDLDPDFEPQSRPRSCTWPLPRPEIANQPSEPPEVEPDLGEKAIESAPEKRLTLA
QIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIKVHNEATGKSSWWMLNPEGGKSGKAPRRRA
ASMDSSSKLLRGRSKAPKKKPSVLPAPPEGATPTSPVGHFAKWSGSPCSRNREEADMWTTFRPRSSSNAS
SVSTRLSPLRPESEVLAEEIPASVSSYAGGVPPTLNEGLELLDGLNLTSSHSLLSRSGLSGFSLQHPGVT
GPLHTYSSSLFSPAEGPLSAGEGCFSSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLGGLPSS
SKLATGVGLCPKPLEAPGPSSLVPTLSMIAPPPVMASAPIPKALGTPVLTPPTEAASQDRMPQDLDLDMY
MENLECDMDNIISDLMDEGEGLDFNFEPDP

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001170931
ORF Size 1350 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001170931.1, NP_001164402
RefSeq Size 3200
Locus ID 4303
Cytogenetics Xq13.1
Protein Families Transcription Factors
Gene Summary This gene encodes a member of the O class of winged helix/forkhead transcription factor family. Proteins encoded by this class are regulated by factors involved in growth and differentiation indicating they play a role in these processes. A translocation involving this gene on chromosome X and the homolog of the Drosophila trithorax gene, encoding a DNA binding protein, located on chromosome 11 is associated with leukemia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.