TATA binding protein (TBP) (NM_001172085) Human Tagged ORF Clone

CAT#: RG229881

Reviews ()
Write a review
  • TrueORF®

TBP (GFP-tagged) - Human TATA box binding protein (TBP), transcript variant 2. Note: ORF is codon optimized



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 517.00


Availability*
Please Inquire

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol TBP
Synonyms GTF2D; GTF2D1; HDL4; SCA17; TFIID
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG229881 ORF sequence, codon optimized.
Due to the complexity of NM_001172085, the ORF clone is codon optimized for mammalian Expression.
The nucleotide sequence differs from the reference sequence, yet the amino acid sequence remains identical
.

Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCCCTGGAATACCCATCTTTAGCCCTATGATGCCTTATGGCACCGGCTTGACTCCTCAGCCAATCC
AGAACACCAATAGTTTGAGTATCCTCGAGGAACAGCAGCGACAGCAGCAACAACAGCAACAGCAGCAGCA
GCAGCAGCAACAGCAGCAGCAGCAGCAACAGCAGCAGCAACAGCAACAGCAGCAGCAACAGCAACAGCAG
CAACAGCAGCAGCAGGCAGTGGCAGCCGCGGCTGTTCAACAGAGCACTTCTCAGCAGGCCACCCAAGGGA
CTTCAGGACAGGCACCCCAACTGTTTCATAGCCAGACTCTGACAACCGCGCCACTGCCAGGAACAACCCC
ACTGTACCCCAGTCCGATGACCCCGATGACTCCCATCACTCCTGCAACTCCCGCTTCTGAGTCTTCTGGT
ATCGTTCCCCAGCTGCAGAATATAGTCTCCACCGTCAATCTGGGTTGTAAGCTTGACCTTAAGACCATCG
CACTGCGGGCTCGGAATGCAGAGTACAACCCGAAACGGTTTGCAGCCGTGATTATGCGCATAAGGGAACC
GAGAACTACTGCCTTGATCTTCTCCTCCGGGAAAATGGTGTGTACAGGCGCCAAGTCAGAAGAACAGTCA
AGACTGGCCGCCAGAAAGTACGCCCGCGTTGTGCAGAAGCTCGGCTTTCCCGCTAAATTTCTGGACTTCA
AAATCCAGAACATGGTCGGCTCCTGCGACGTGAAGTTCCCTATAAGACTGGAGGGACTGGTGCTGACGCA
CCAACAGTTTAGCTCTTACGAACCAGAGCTGTTCCCAGGTCTGATATATAGGATGATTAAGCCGAGAATA
GTGCTTCTCATCTTTGTGAGCGGGAAAGTGGTGCTGACTGGCGCCAAAGTTCGGGCCGAAATTTACGAAG
CCTTCGAAAATATTTATCCGATCCTGAAGGGGTTTCGAAAGACAACA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG229881 representing NM_001172085
Red=Cloning site Green=Tags(s)

MTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSG
IVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQS
RLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRI
VLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001172085
ORF Size 957 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001172085.1, NP_001165556.1
RefSeq Size 1719 bp
RefSeq ORF 960 bp
Locus ID 6908
UniProt ID P20226
Cytogenetics 6q27
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Basal transcription factors, Huntington's disease
Gene Summary Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes TBP, the TATA-binding protein. A distinctive feature of TBP is a long string of glutamines in the N-terminus. This region of the protein modulates the DNA binding activity of the C terminus, and modulation of DNA binding affects the rate of transcription complex formation and initiation of transcription. The number of CAG repeats encoding the polyglutamine tract is usually 25-42, and expansion of the number of repeats to 45-66 increases the length of the polyglutamine string and is associated with spinocerebellar ataxia 17, a neurodegenerative disorder classified as a polyglutamine disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2016]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.