SVH (ARMC10) (NM_001161012) Human Tagged ORF Clone

CAT#: RG228181

  • TrueORF®

ARMC10 (tGFP-tagged) - Human armadillo repeat containing 10 (ARMC10), transcript variant D

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_001161012" in other vectors (4)

Reconstitution Protocol

USD 530.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


Rabbit Polyclonal Anti-ARMC10 Antibody
    • 100 ul

USD 380.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol SVH
Synonyms PNAS-112; PNAS112; PSEC0198; SVH
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG228181 representing NM_001161012
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTGGCCCCCGGGGCGCGGGCTGGGTGGCGGCGGGCCTGCTGCTCGGCGCGGGCGCCTGCTACTGCA
TTTACAGGCTGACCCGGGGTCGGCGGCGGGGCGACCGCGAGCTCGGGATACGCTCTTCGAAGTCCGCAGA
AGACTTAACTGATGGTTCATATGATGATGTTCTAAATGCTGAACAACTTCAGAAACTCCTTTACCTGCTG
GAGTCAACGGAGGATCCTGTAATTATTGAAAGAGCTTTGATTACTTTGGGTAACAATGCAGCCTTTTCAG
TTAACCAAGCTATTATTCGTGAATTGGGTGGTATTCCAATTGTTGCAAACAAAATCAACCATTCCAACCA
GAGTATTAAAGAGAAAGCTTTAAATGCACTAAATAACCTGAGTGTGAATGTTGAAAATCAAATCAAGATA
AAGGTGCAAGTTTTGAAACTGCTTTTGAATTTGTCTGAAAATCCAGCCATGACAGAAGGACTTCTCCGTG
CCCAAGTGGATTCATCATTCCTTTCCCTTTATGACAGCCACGTAGCAAAGGAGATTCTTCTTCGAGTACT
TACGCTATTTCAGAATATAAAGAACTGCCTCAAAATAGAAGGCCATTTAGCTGTGCAGCCTACTTTCACT
GAAGGTTCATTGTTTTTCCTGTTACATGGAGAAGAATGTGCCCAGAAAATAAGAGCTTTAGTTGATCACC
ATGATGCAGAGGTGAAGGAAAAGGTTGTAACAATAATACCCAAAATC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG228181 representing NM_001161012
Red=Cloning site Green=Tags(s)

MGGPRGAGWVAAGLLLGAGACYCIYRLTRGRRRGDRELGIRSSKSAEDLTDGSYDDVLNAEQLQKLLYLL
ESTEDPVIIERALITLGNNAAFSVNQAIIRELGGIPIVANKINHSNQSIKEKALNALNNLSVNVENQIKI
KVQVLKLLLNLSENPAMTEGLLRAQVDSSFLSLYDSHVAKEILLRVLTLFQNIKNCLKIEGHLAVQPTFT
EGSLFFLLHGEECAQKIRALVDHHDAEVKEKVVTIIPKI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001161012
ORF Size 747 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001161012.3
RefSeq Size 2369 bp
RefSeq ORF 750 bp
Locus ID 83787
UniProt ID Q8N2F6
Cytogenetics 7q22.1
Protein Families Transmembrane
Gene Summary This gene encodes a protein that contains an armadillo repeat and transmembrane domain. The encoded protein decreases the transcriptional activity of the tumor suppressor protein p53 through direct interaction with the DNA-binding domain of p53, and may play a role in cell growth and survival. Upregulation of this gene may play a role in hepatocellular carcinoma. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 3. [provided by RefSeq, Sep 2011]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.