ROBO1 (NM_001145844) Human Tagged ORF Clone

CAT#: RG227713

Reviews ()
Write a review
  • TrueORF®

ROBO1 (GFP-tagged) - Human roundabout, axon guidance receptor, homolog 1 (Drosophila) (ROBO1), transcript variant 3


  View "NM_001145844" in other vectors (10)

USD 2,120.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ROBO1 (NM_001145844) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol ROBO1
Synonyms axon guidance receptor; DUTT1; FLJ21882; MGC131599; MGC133277; roundabout, axon guidance receptor, homolog 1 (Drosophila); roundabout 1; SAX3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG227713 representing NM_001145844
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATTGCGGAGCCCGCTCACTTTTACCTGTTTGGATTAATATGTCTCTGTTCAGGCTCCCGTCTTCGTC
AGGAAGATTTTCCACCTCGCATTGTTGAACACCCTTCAGACCTGATTGTCTCAAAAGGAGAACCTGCAAC
TTTGAACTGCAAAGCTGAAGGCCGCCCCACACCCACTATTGAATGGTACAAAGGGGGAGAGAGAGTGGAG
ACAGACAAAGATGACCCTCGCTCACACCGAATGTTGCTGCCGAGTGGATCTTTATTTTTCTTACGTATAG
TACATGGACGGAAAAGTAGACCTGATGAAGGAGTCTATGTCTGTGTAGCAAGGAATTACCTTGGAGAGGC
TGTGAGCCACAATGCATCGCTGGAAGTAGCCATACTTCGGGATGACTTCAGACAAAACCCTTCGGATGTC
ATGGTTGCAGTAGGAGAGCCTGCAGTAATGGAATGCCAACCTCCACGAGGCCATCCTGAGCCCACCATTT
CATGGAAGAAAGATGGCTCTCCACTGGATGATAAAGATGAAAGAATAACTATACGAGGAGGAAAGCTCAT
GATCACTTACACCCGTAAAAGTGACGCTGGCAAATATGTTTGTGTTGGTACCAATATGGTTGGGGAACGT
GAGAGTGAAGTAGCCGAGCTGACTGTCTTAGAGAGACCATCATTTGTGAAGAGACCCAGTAACTTGGCAG
TAACTGTGGATGACAGTGCAGAATTTAAATGTGAGGCCCGAGGTGACCCTGTACCTACAGTACGATGGAG
GAAAGATGATGGAGAGCTGCCCAAATCCAGATATGAAATCCGAGATGATCATACCTTGAAAATTAGGAAG
GTGACAGCTGGTGACATGGGTTCATACACTTGTGTTGCAGAAAATATGGTGGGCAAAGCTGAAGCATCTG
CTACTCTGACTGTTCAAGTTGGGTCTGAACCTCCACATTTTGTTGTGAAACCCCGTGACCAGGTTGTTGC
TTTGGGACGGACTGTAACTTTTCAGTGTGAAGCAACCGGAAATCCTCAACCAGCTATTTTCTGGAGGAGA
GAAGGGAGTCAGAATCTACTTTTCTCATATCAACCACCACAGTCATCCAGCCGATTTTCAGTCTCCCAGA
CTGGCGACCTCACAATTACTAATGTCCAGCGATCTGATGTTGGTTATTACATCTGCCAGACTTTAAATGT
TGCTGGAAGCATCATCACAAAGGCATATTTGGAAGTTACAGATGTGATTGCAGATCGGCCTCCCCCAGTT
ATTCGACAAGGTCCTGTGAATCAGACTGTAGCCGTGGATGGCACTTTCGTCCTCAGCTGTGTGGCCACAG
GCAGTCCAGTGCCCACCATTCTGTGGAGAAAGGATGGAGTCCTCGTTTCAACCCAAGACTCTCGAATCAA
ACAGTTGGAGAATGGAGTACTGCAGATCCGATATGCTAAGCTGGGTGATACTGGTCGGTACACCTGCATT
GCATCAACCCCCAGTGGTGAAGCAACATGGAGTGCTTACATTGAAGTTCAAGAATTTGGAGTTCCAGTTC
AGCCTCCAAGACCTACTGACCCAAATTTAATCCCTAGTGCCCCATCAAAACCTGAAGTGACAGATGTCAG
CAGAAATACAGTCACATTATCATGGCAACCAAATTTGAATTCAGGAGCAACTCCAACATCTTATATTATA
GAAGCCTTCAGCCATGCATCTGGTAGCAGCTGGCAGACCGTAGCAGAGAATGTGAAAACAGAAACATCTG
CCATTAAAGGACTCAAACCTAATGCAATTTACCTTTTCCTTGTGAGGGCAGCTAATGCATATGGAATTAG
TGATCCAAGCCAAATATCAGATCCAGTGAAAACACAAGATGTCCTACCAACAAGTCAGGGGGTGGACCAC
AAGCAGGTCCAGAGAGAGCTGGGAAATGCTGTTCTGCACCTCCACAACCCCACCGTCCTTTCTTCCTCTT
CCATCGAAGTGCACTGGACAGTAGATCAACAGTCTCAGTATATACAAGGATATAAAATTCTCTATCGGCC
ATCTGGAGCCAACCACGGAGAATCAGACTGGTTAGTTTTTGAAGTGAGGACGCCAGCCAAAAACAGTGTG
GTAATCCCTGATCTCAGAAAGGGAGTCAACTATGAAATTAAGGCTCGCCCTTTTTTTAATGAATTTCAAG
GAGCAGATAGTGAAATCAAGTTTGCCAAAACCCTGGAAGAAGCACCCAGTGCCCCACCCCAAGGTGTAAC
TGTATCCAAGAATGATGGAAACGGAACTGCAATTCTAGTTAGTTGGCAGCCACCTCCAGAAGACACTCAA
AATGGAATGGTCCAAGAGTATAAGGTTTGGTGTCTGGGCAATGAAACTCGATACCACATCAACAAAACAG
TGGATGGTTCCACCTTTTCCGTGGTCATTCCCTTTCTTGTTCCTGGAATCCGATACAGTGTGGAAGTGGC
AGCCAGCACTGGGGCTGGGTCTGGGGTAAAGAGTGAGCCTCAGTTCATCCAGCTGGATGCCCATGGAAAC
CCTGTGTCACCTGAGGACCAAGTCAGCCTCGCTCAGCAGATTTCAGATGTGGTGAAGCAGCCGGCCTTCA
TAGCAGGTATTGGAGCAGCCTGTTGGATCATCCTCATGGTCTTCAGCATCTGGCTTTATCGACACCGCAA
GAAGAGAAACGGACTTACTAGTACATACGCGGGTATCAGAAAAGTAACTTACCAGAGAGGAGGCGAAGCT
GTCAGCAGTGGAGGGAGGCCTGGACTTCTCAACATCAGTGAACCTGCCGCGCAGCCATGGCTGGCAGACA
CGTGGCCTAATACTGGCAACAACCACAATGACTGCTCCATCAGCTGCTGCACGGCAGGCAATGGAAACAG
CGACAGCAACCTCACTACCTACAGTCGCCCAGCTGATTGTATAGCAAATTATAACAACCAACTGGATAAC
AAACAAACAAATCTGATGCTCCCTGAGTCAACTGTTTATGGTGATGTGGACCTTAGTAACAAAATCAATG
AGATGAAAACCTTCAATAGCCCAAATCTGAAGGATGGGCGTTTTGTCAATCCATCAGGGCAGCCTACTCC
TTACGCCACCACTCAGCTCATCCAGTCAAACCTCAGCAACAACATGAACAATGGCAGCGGGGACTCTGGC
GAGAAGCACTGGAAACCACTGGGACAGCAGAAACAAGAAGTGGCACCAGTTCAGTACAACATCGTGGAGC
AAAACAAGCTGAACAAAGATTATCGAGCAAATGACACAGTTCCTCCAACTATCCCATACAACCAATCATA
CGACCAGAACACAGGAGGATCCTACAACAGCTCAGACCGGGGCAGTAGTACATCTGGGAGTCAGGGGCAC
AAGAAAGGGGCAAGAACACCCAAGGTACCAAAACAGGGTGGCATGAACTGGGCAGACCTGCTTCCTCCTC
CCCCAGCACATCCTCCTCCACACAGCAATAGCGAAGAGTACAACATTTCTGTAGATGAAAGCTATGACCA
AGAAATGCCATGTCCCGTGCCACCAGCAAGGATGTATTTGCAACAAGATGAATTAGAAGAGGAGGAAGAT
GAACGAGGCCCCACTCCCCCTGTTCGGGGAGCAGCTTCTTCTCCAGCTGCCGTGTCCTATAGCCATCAGT
CCACTGCCACTCTGACTCCCTCCCCACAGGAAGAACTCCAGCCCATGTTACAGGATTGTCCAGAGGAGAC
TGGCCACATGCAGCACCAGCCCGACAGGAGACGGCAGCCTGTGAGTCCTCCTCCACCACCACGGCCGATC
TCCCCTCCACATACCTATGGCTACATTTCAGGACCCCTGGTCTCAGATATGGATACGGATGCGCCAGAAG
AGGAAGAAGACGAAGCCGACATGGAGGTAGCCAAGATGCAAACCAGAAGGCTTTTGTTACGTGGGCTTGA
GCAGACACCTGCCTCCAGTGTTGGGGACCTGGAGAGCTCTGTCACGGGGTCCATGATCAACGGCTGGGGC
TCAGCCTCAGAGGAGGACAACATTTCCAGCGGACGCTCCAGTGTTAGTTCTTCGGACGGCTCCTTTTTCA
CTGATGCTGACTTTGCCCAGGCAGTCGCAGCAGCGGCAGAGTATGCTGGTCTGAAAGTAGCACGACGGCA
AATGCAGGATGCTGCTGGCCGTCGACATTTTCATGCGTCTCAGTGCCCTAGGCCCACAAGTCCCGTGTCT
ACAGACAGCAACATGAGTGCCGCCGTAATGCAGAAAACCAGACCAGCCAAGAAACTGAAACACCAGCCAG
GACATCTGCGCAGAGAAACCTACACAGATGATCTTCCACCACCTCCTGTGCCGCCACCTGCTATAAAGTC
ACCTACTGCCCAATCCAAGACACAGCTGGAAGTACGACCTGTAGTGGTGCCAAAACTCCCTTCTATGGAT
GCAAGAACAGACAGATCATCAGACAGAAAAGGAAGCAGTTACAAGGGGAGAGAAGTGTTGGATGGAAGAC
AGGTTGTTGACATGCGAACAAATCCAGGTGATCCCAGAGAAGCACAGGAACAGCAAAATGACGGGAAAGG
ACGTGGAAACAAGGCAGCAAAACGAGACCTTCCACCAGCAAAGACTCATCTCATCCAAGAGGATATTCTA
CCTTATTGTAGACCTACTTTTCCAACATCAAATAATCCCAGAGATCCCAGTTCCTCAAGCTCAATGTCAT
CAAGAGGATCAGGAAGCAGACAAAGAGAACAAGCAAATGTAGGTCGAAGAAATATTGCAGAAATGCAGGT
ACTTGGAGGATATGAAAGAGGAGAAGATAATAATGAAGAATTAGAGGAAACTGAAAGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG227713 representing NM_001145844
Red=Cloning site Green=Tags(s)

MIAEPAHFYLFGLICLCSGSRLRQEDFPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVE
TDKDDPRSHRMLLPSGSLFFLRIVHGRKSRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDV
MVAVGEPAVMECQPPRGHPEPTISWKKDGSPLDDKDERITIRGGKLMITYTRKSDAGKYVCVGTNMVGER
ESEVAELTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRKDDGELPKSRYEIRDDHTLKIRK
VTAGDMGSYTCVAENMVGKAEASATLTVQVGSEPPHFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRR
EGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQRSDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPV
IRQGPVNQTVAVDGTFVLSCVATGSPVPTILWRKDGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCI
ASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGATPTSYII
EAFSHASGSSWQTVAENVKTETSAIKGLKPNAIYLFLVRAANAYGISDPSQISDPVKTQDVLPTSQGVDH
KQVQRELGNAVLHLHNPTVLSSSSIEVHWTVDQQSQYIQGYKILYRPSGANHGESDWLVFEVRTPAKNSV
VIPDLRKGVNYEIKARPFFNEFQGADSEIKFAKTLEEAPSAPPQGVTVSKNDGNGTAILVSWQPPPEDTQ
NGMVQEYKVWCLGNETRYHINKTVDGSTFSVVIPFLVPGIRYSVEVAASTGAGSGVKSEPQFIQLDAHGN
PVSPEDQVSLAQQISDVVKQPAFIAGIGAACWIILMVFSIWLYRHRKKRNGLTSTYAGIRKVTYQRGGEA
VSSGGRPGLLNISEPAAQPWLADTWPNTGNNHNDCSISCCTAGNGNSDSNLTTYSRPADCIANYNNQLDN
KQTNLMLPESTVYGDVDLSNKINEMKTFNSPNLKDGRFVNPSGQPTPYATTQLIQSNLSNNMNNGSGDSG
EKHWKPLGQQKQEVAPVQYNIVEQNKLNKDYRANDTVPPTIPYNQSYDQNTGGSYNSSDRGSSTSGSQGH
KKGARTPKVPKQGGMNWADLLPPPPAHPPPHSNSEEYNISVDESYDQEMPCPVPPARMYLQQDELEEEED
ERGPTPPVRGAASSPAAVSYSHQSTATLTPSPQEELQPMLQDCPEETGHMQHQPDRRRQPVSPPPPPRPI
SPPHTYGYISGPLVSDMDTDAPEEEEDEADMEVAKMQTRRLLLRGLEQTPASSVGDLESSVTGSMINGWG
SASEEDNISSGRSSVSSSDGSFFTDADFAQAVAAAAEYAGLKVARRQMQDAAGRRHFHASQCPRPTSPVS
TDSNMSAAVMQKTRPAKKLKHQPGHLRRETYTDDLPPPPVPPPAIKSPTAQSKTQLEVRPVVVPKLPSMD
ARTDRSSDRKGSSYKGREVLDGRQVVDMRTNPGDPREAQEQQNDGKGRGNKAAKRDLPPAKTHLIQEDIL
PYCRPTFPTSNNPRDPSSSSSMSSRGSGSRQREQANVGRRNIAEMQVLGGYERGEDNNEELEETES

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001145844
ORF Size 4818 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001145844.1, NP_001139316.1
RefSeq Size 7550
RefSeq ORF 4820
Locus ID 6091
Cytogenetics 3p12.3
Protein Families Druggable Genome
Protein Pathways Axon guidance
Gene Summary Bilateral symmetric nervous systems have special midline structures that establish a partition between the two mirror image halves. Some axons project toward and across the midline in response to long-range chemoattractants emanating from the midline. The product of this gene is a member of the immunoglobulin gene superfamily and encodes an integral membrane protein that functions in axon guidance and neuronal precursor cell migration. This receptor is activated by SLIT-family proteins, resulting in a repulsive effect on glioma cell guidance in the developing brain. A related gene is located at an adjacent region on chromosome 3. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]

Other Versions

Other products for "ROBO1"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


Rabbit polyclonal anti-ROBO-1 antibody
    • 100 ug

USD 530.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones