bcl 6 (BCL6) (NM_001130845) Human Tagged ORF Clone

CAT#: RG226102

Reviews ()
Write a review
  • TrueORF®

BCL6 (GFP-tagged) - Human B-cell CLL/lymphoma 6 (BCL6), transcript variant 2



  "NM_001130845" in other vectors (4)

USD 460.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name bcl 6 (BCL6) (NM_001130845) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol BCL6
Synonyms BCL5; BCL6A; LAZ3; ZBTB27; ZNF51
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG226102 representing NM_001130845
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCGCCGGCTGACAGCTGTATCCAGTTCACCCGCCATGCCAGTGATGTTCTTCTCAACCTTAATC
GTCTCCGGAGTCGAGACATCTTGACTGATGTTGTCATTGTTGTGAGCCGTGAGCAGTTTAGAGCCCATAA
AACGGTCCTCATGGCCTGCAGTGGCCTGTTCTATAGCATCTTTACAGACCAGTTGAAATGCAACCTTAGT
GTGATCAATCTAGATCCTGAGATCAACCCTGAGGGATTCTGCATCCTCCTGGACTTCATGTACACATCTC
GGCTCAATTTGCGGGAGGGCAACATCATGGCTGTGATGGCCACGGCTATGTACCTGCAGATGGAGCATGT
TGTGGACACTTGCCGGAAGTTTATTAAGGCCAGTGAAGCAGAGATGGTTTCTGCCATCAAGCCTCCTCGT
GAAGAGTTCCTCAACAGCCGGATGCTGATGCCCCAAGACATCATGGCCTATCGGGGTCGTGAGGTGGTGG
AGAACAACCTGCCACTGAGGAGCGCCCCTGGGTGTGAGAGCAGAGCCTTTGCCCCCAGCCTGTACAGTGG
CCTGTCCACACCGCCAGCCTCTTATTCCATGTACAGCCACCTCCCTGTCAGCAGCCTCCTCTTCTCCGAT
GAGGAGTTTCGGGATGTCCGGATGCCTGTGGCCAACCCCTTCCCCAAGGAGCGGGCACTCCCATGTGATA
GTGCCAGGCCAGTCCCTGGTGAGTACAGCCGGCCGACTTTGGAGGTGTCCCCCAATGTGTGCCACAGCAA
TATCTATTCACCCAAGGAAACAATCCCAGAAGAGGCACGAAGTGATATGCACTACAGTGTGGCTGAGGGC
CTCAAACCTGCTGCCCCCTCAGCCCGAAATGCCCCCTACTTCCCTTGTGACAAGGCCAGCAAAGAAGAAG
AGAGACCCTCCTCGGAAGATGAGATTGCCCTGCATTTCGAGCCCCCCAATGCACCCCTGAACCGGAAGGG
TCTGGTTAGTCCACAGAGCCCCCAGAAATCTGACTGCCAGCCCAACTCGCCCACAGAGTCCTGCAGCAGT
AAGAATGCCTGCATCCTCCAGGCTTCTGGCTCCCCTCCAGCCAAGAGCCCCACTGACCCCAAAGCCTGCA
ACTGGAAGAAATACAAGTTCATCGTGCTCAACAGCCTCAACCAGAATGCCAAACCAGAGGGGCCTGAGCA
GGCTGAGCTGGGCCGCCTTTCCCCACGAGCCTACACGGCCCCACCTGCCTGCCAGCCACCCATGGAGCCT
GAGAACCTTGACCTCCAGTCCCCAACCAAGCTGAGTGCCAGCGGGGAGGACTCCACCATCCCACAAGCCA
GCCGGCTCAATAACATCGTTAACAGGTCCATGACGGGCTCTCCCCGCAGCAGCAGCGAGAGCCACTCACC
ACTCTACATGCACCCCCCGAAGTGCACGTCCTGCGGCTCTCAGTCCCCACAGCATGCAGAGATGTGCCTC
CACACCGCTGGCCCCACGTTCCCTGAGGAGATGGGAGAGACCCAGTCTGAGTACTCAGATTCTAGCTGTG
AGAACGGGGCCTTCTTCTGCAATGAGTGTGACTGCCGCTTCTCTGAGGAGGCCTCACTCAAGAGGCACAC
GCTGCAGACCCACAGTGACAAACCCTACAAGTGTGACCGCTGCCAGGCCTCCTTCCGCTACAAGGGCAAC
CTCGCCAGCCACAAGACCGTCCATACCGGTGAGAAACCCTATCGTTGCAACATCTGTGGGGCCCAGTTCA
ACCGGCCAGCCAACCTGAAAACCCACACTCGAATTCACTCTGGAGAGAAGCCCTACAAATGCGAAACCTG
CGGAGCCAGATTTGTACAGGTGGCCCACCTCCGTGCCCATGTGCTTATCCACACTGGTGAGAAGCCCTAT
CCCTGTGAAATCTGTGGCACCCGTTTCCGGCACCTTCAGACTCTGAAGAGCCACCTGCGAATCCACACAG
GAGAGAAACCTTACCATTGTGAGAAGTGTAACCTGCATTTCCGTCACAAAAGCCAGCTGCGACTTCACTT
GCGCCAGAAGCATGGCGCCATCACCAACACCAAGGTGCAATACCGCGTGTCAGCCACTGACCTGCCTCCG
GAGCTCCCCAAAGCCTGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG226102 representing NM_001130845
Red=Cloning site Green=Tags(s)

MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLS
VINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIKASEAEMVSAIKPPR
EEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAFAPSLYSGLSTPPASYSMYSHLPVSSLLFSD
EEFRDVRMPVANPFPKERALPCDSARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEG
LKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSS
KNACILQASGSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEP
ENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGSQSPQHAEMCL
HTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQTHSDKPYKCDRCQASFRYKGN
LASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEKPYKCETCGARFVQVAHLRAHVLIHTGEKPY
PCEICGTRFRHLQTLKSHLRIHTGEKPYHCEKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPP
ELPKAC

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001130845
ORF Size 2118 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001130845.1, NP_001124317.1
RefSeq Size 3662 bp
RefSeq ORF 2121 bp
Locus ID 604
Cytogenetics 3q27.3
Protein Families Druggable Genome, Transcription Factors
Gene Summary The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of STAT-dependent IL-4 responses of B cells. This protein can interact with a variety of POZ-containing proteins that function as transcription corepressors. This gene is found to be frequently translocated and hypermutated in diffuse large-cell lymphoma (DLCL), and may be involved in the pathogenesis of DLCL. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Aug 2015]

Citations (1)

Other Versions

Other products for "BCL6"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


Purified BCL6 mouse monoclonal antibody, clone OTI6C7 (formerly 6C7)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools