SGLT2 (SLC5A2) (NM_003041) Human Tagged ORF Clone

CAT#: RG224822

Reviews ()
Write a review
  • TrueORF®

SLC5A2 (GFP-tagged) - Human solute carrier family 5 (sodium/glucose cotransporter), member 2 (SLC5A2)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 815.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol SLC5A2
Synonyms SGLT2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG224822 representing NM_003041
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAGCACACAGAGGCAGGCTCGGCACCAGAGATGGGGGCCCAGAAGGCCCTGATTGACAATCCTG
CTGACATCCTAGTCATTGCTGCATATTTCCTGCTGGTCATTGGCGTTGGCTTGTGGTCCATGTGCAGAAC
CAACAGAGGCACTGTGGGCGGCTACTTCCTGGCAGGACGCAGCATGGTGTGGTGGCCGGTTGGGGCCTCT
CTCTTCGCCAGCAACATCGGCAGTGGCCACTTTGTGGGCCTGGCAGGGACTGGCGCTGCAAGTGGCTTGG
CTGTTGCTGGATTCGAGTGGAATGCGCTCTTCGTGGTGCTGCTACTGGGCTGGCTGTTTGCACCCGTGTA
CCTGACAGCGGGGGTCATCACGATGCCACAGTACCTGCGCAAGCGCTTCGGCGGCCGCCGCATCCGCCTC
TACCTGTCTGTGCTCTCCCTTTTCCTGTACATCTTCACCAAGATCTCAGTGGACATGTTCTCCGGAGCTG
TATTCATCCAGCAGGCTCTGGGCTGGAACATCTATGCCTCCGTCATCGCGCTTCTGGGCATCACCATGAT
TTACACGGTGACAGGAGGGCTGGCCGCGCTGATGTACACGGACACGGTACAGACCTTCGTCATTCTGGGG
GGCGCCTGCATCCTCATGGGTTACGCCTTCCACGAGGTGGGCGGGTATTCGGGTCTCTTCGACAAATACC
TGGGAGCAGCGACTTCGCTGACGGTGTCCGAGGATCCAGCCGTGGGAAACATCTCCAGCTTCTGCTATCG
ACCCCGGCCCGACTCCTACCACCTGCTCCGGCACCCCGTGACCGGGGATCTGCCGTGGCCCGCGCTGCTC
CTCGGACTCACAATCGTCTCGGGCTGGTACTGGTGCAGCGACCAGGTCATCGTGCAGCGCTGCCTGGCCG
GGAAGAGCCTGACCCACATCAAGGCGGGCTGCATCCTGTGTGGGTACCTGAAGCTGACGCCCATGTTTCT
CATGGTCATGCCAGGCATGATCAGCCGCATTCTGTACCCAGACGAGGTGGCGTGCGTGGTGCCTGAGGTG
TGCAGGCGCGTGTGCGGCACGGAGGTGGGCTGCTCCAACATCGCCTACCCGCGGCTCGTCGTGAAGCTCA
TGCCCAACGGTCTGCGCGGACTCATGCTGGCGGTCATGCTGGCCGCGCTCATGTCCTCGCTGGCCTCCAT
CTTCAACAGCAGCAGCACGCTCTTCACCATGGACATCTACACGCGCCTGCGGCCACGCGCCGGCGACCGC
GAGCTGCTGCTGGTGGGACGGCTCTGGGTGGTGTTCATCGTGGTAGTGTCGGTGGCCTGGCTTCCCGTGG
TGCAGGCGGCACAGGGCGGGCAGCTCTTCGATTACATCCAGGCAGTCTCTAGCTACCTGGCACCGCCCGT
GTCCGCCGTCTTCGTGCTGGCGCTCTTCGTGCCGCGCGTTAATGAGCAGGGCGCCTTCTGGGGACTCATC
GGGGGCCTGCTGATGGGCCTGGCACGCCTGATTCCCGAGTTCTCCTTCGGCTCGGGCAGCTGTGTGCAGC
CCTCGGCGTGCCCAGCTTTCCTCTGCGGCGTGCACTACCTCTACTTCGCCATTGTGCTGTTCTTCTGCTC
TGGCCTCCTCACCCTCACGGTCTCCCTGTGCACCGCGCCCATCCCCAGAAAGCACCTCCACCGCCTGGTC
TTCAGTCTCCGGCATAGCAAGGAGGAACGGGAGGACCTGGATGCTGATGAGCAGCAAGGCTCCTCACTCC
CTGTACAGAATGGGTGCCCAGAGAGTGCCATGGAGATGAATGAGCCCCAGGCCCCGGCACCAAGCCTCTT
CCGCCAGTGCCTGCTCTGGTTTTGTGGAATGAGCAGAGGTGGGGTGGGCAGTCCTCCGCCCCTTACCCAG
GAGGAGGCAGCGGCAGCAGCCAGGCGGCTGGAGGACATCAGCGAGGACCCGAGCTGGGCCCGTGTGGTCA
ACCTCAATGCCCTGCTCATGATGGCAGTGGCCGTGTTCCTCTGGGGCTTCTATGCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG224822 representing NM_003041
Red=Cloning site Green=Tags(s)

MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGAS
LFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTAGVITMPQYLRKRFGGRRIRL
YLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIALLGITMIYTVTGGLAALMYTDTVQTFVILG
GACILMGYAFHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALL
LGLTIVSGWYWCSDQVIVQRCLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEV
CRRVCGTEVGCSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDR
ELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRVNEQGAFWGLI
GGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLLTLTVSLCTAPIPRKHLHRLV
FSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQAPAPSLFRQCLLWFCGMSRGGVGSPPPLTQ
EEAAAAARRLEDISEDPSWARVVNLNALLMMAVAVFLWGFYA

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003041
ORF Size 2016 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003041.4
RefSeq Size 2271 bp
RefSeq ORF 2019 bp
Locus ID 6524
UniProt ID P31639
Cytogenetics 16p11.2
Protein Families Transmembrane
Gene Summary This gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associated with renal glucosuria. Two transcript variants, one protein-coding and one not, have been found for this gene. [provided by RefSeq, Feb 2015]
Other products for "SLC5A2"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.