AP2S1 (NM_021575) Human Tagged ORF Clone

CAT#: RG223424

Reviews ()
Write a review
  • TrueORF®

AP2S1 (GFP-tagged) - Human adaptor-related protein complex 2, sigma 1 subunit (AP2S1), transcript variant AP17delta



  "NM_021575" in other vectors (4)

USD 460.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name AP2S1 (NM_021575) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol AP2S1
Synonyms AP17; CLAPS2; FBH3; FBHOk; HHC3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG223424 representing NM_021575
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCCGCTTTATCCTCATCCAGAACCGGGCAGGCAAGACGCGCCTGGCCAAGTGGTACATGCAGTTTG
ATGATGATGAGAAACAGAAGCTGATCGAGGAGGTGCATGCCGTGGTCACCGTCCGAGACGCCAAACACAC
CAACTTTGTGGAGTTCCGGAACTTTAAGATCATTTACCGCCGCTATGCTGGCCTCTACTTCTGCATCTGT
GTGGATGTCAATGACAACAACCTGGCTTACCTGGAGGCCATTCACAACTTCGTGGAGGTCTTAAACGAAT
ATTTCCACAATGTCTGTGAACTGGACCTGGTGTTCAACTTCTACAAGGTTTACACGGTCGTGGACGAGAT
GTTCCTGGCTGGCGAAATCCGAGAGACCAGCCAGACGAAGGTGCTGAAACAGCTGCTGATGCTACAGTCC
CTGGAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG223424 representing NM_021575
Red=Cloning site Green=Tags(s)

MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCIC
VDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQS
LE

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_021575
ORF Size 426 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_021575.2, NP_067586.1
RefSeq Size 776 bp
RefSeq ORF 315 bp
Locus ID 1175
Cytogenetics 19q13.32
Domains Clat_adaptor_s
Protein Pathways Endocytosis, Huntington's disease
Gene Summary One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Citations (1)

Other Versions

Other products for "AP2S1"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


Anti-AP2S1 Rabbit Polyclonal Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools