RALY (NM_007367) Human Tagged ORF Clone

CAT#: RG223333

Reviews ()
Write a review
  • TrueORF®

RALY (GFP-tagged) - Human RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse)) (RALY), transcript variant 2


Product Datasheet for 'RG223333'


  "NM_007367" in other vectors (4)

Need a mutant or fragment? Switch to a different vector? Get a free quote.

USD 460.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name RALY (NM_007367) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol RALY
Synonyms HNRPCL2; P542
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG223333 representing NM_007367
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTTGAAGCTTCAGGCAAGCAATGTAACCAACAAGAATGACCCCAAGTCCATCAACTCTCGAGTCT
TCATTGGAAACCTCAACACAGCTCTGGTGAAGAAATCAGATGTGGAGACCATCTTCTCTAAGTATGGCCG
TGTGGCCGGCTGTTCTGTGCACAAGGGCTATGCCTTTGTTCAGTACTCCAATGAGCGCCATGCCCGGGCA
GCTGTGCTGGGAGAGAATGGGCGGGTGCTGGCCGGGCAGACCCTGGACATCAACATGGCTGGAGAGCCTA
AGCCTGACAGACCCAAGGGGCTAAAGAGAGCAGCATCTGCCATATACAGGCTCTTCGACTACCGGGGCCG
TCTGTCGCCCGTGCCAGTGCCCAGGGCGGTCCCTGTGAAGCGACCCCGGGTCACAGTCCCTTTGGTCCGG
CGTGTCAAAACTAACGTACCTGTCAAGCTCTTTGCCCGCTCCACAGCTGTCACCACCAGCTCAGCCAAGA
TCAAGTTAAAGAGCAGTGAGCTGCAGGCCATCAAGACGGAGCTGACACAGATCAAGTCCAATATCGATGC
CCTGCTGAGCCGCTTGGAGCAGATCGCTGCGGAGCAAAAGGCCAATCCAGATGGCAAGAAGAAGGGTGAT
GGAGGTGGCGCCGGCGGCGGCGGCGGTGGTGGTGGCAGCGGTGGCGGTGGCAGTGGTGGTGGCGGTGGCG
GTGGCAGCAGCCGGCCACCAGCCCCCCAAGAGAACACAACTTCTGAGGCAGGCCTGCCCCAGGGGGAAGC
ACGGACCCGAGACGACGGCGATGAGGAAGGGCTCCTGACACACAGCGAGGAAGAGCTGGAACACAGCCAG
GACACAGACGCGGATGATGGGGCCTTGCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG223333 representing NM_007367
Red=Cloning site Green=Tags(s)

MSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQYSNERHARA
AVLGENGRVLAGQTLDINMAGEPKPDRPKGLKRAASAIYRLFDYRGRLSPVPVPRAVPVKRPRVTVPLVR
RVKTNVPVKLFARSTAVTTSSAKIKLKSSELQAIKTELTQIKSNIDALLSRLEQIAAEQKANPDGKKKGD
GGGAGGGGGGGGSGGGGSGGGGGGGSSRPPAPQENTTSEAGLPQGEARTRDDGDEEGLLTHSEEELEHSQ
DTDADDGALQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_007367
ORF Size 870 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_007367.2, NP_031393.2
RefSeq Size 1541
RefSeq ORF 873
Locus ID 22913
Cytogenetics 20q11.22
Domains RRM
Gene Summary This gene encodes a member of the heterogeneous nuclear ribonucleoprotein (hnRNP) gene family. This protein may play a role in pre-mRNA splicing and in embryonic development. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]

Other Versions

Other products for "RALY"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


Rabbit polyclonal anti-RALY antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools