UNG (NM_080911) Human Tagged ORF Clone

CAT#: RG222868

  • TrueORF®

UNG (tGFP-tagged) - Human uracil-DNA glycosylase (UNG), transcript variant 2

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro


  "NM_080911" in other vectors (6)

Reconstitution Protocol

USD 650.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


UNG mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)
    • 100 ul

USD 447.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol UNG
Synonyms DGU; HIGM4; HIGM5; UDG; UNG1; UNG2; UNG15
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG222868 representing NM_080911
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCGGCCAGAAGACGCTCTACTCCTTTTTCTCCCCCAGCCCCGCCAGGAAGCGACACGCCCCCAGCC
CCGAGCCGGCCGTCCAGGGGACCGGCGTGGCTGGGGTGCCTGAGGAAAGCGGAGATGCGGCGGCCATCCC
AGCCAAGAAGGCCCCGGCTGGGCAGGAGGAGCCTGGGACGCCGCCCTCCTCGCCGCTGAGTGCCGAGCAG
TTGGACCGGATCCAGAGGAACAAGGCCGCGGCCCTGCTCAGACTCGCGGCCCGCAACGTGCCCGTGGGCT
TTGGAGAGAGCTGGAAGAAGCACCTCAGCGGGGAGTTCGGGAAACCGTATTTTATCAAGCTAATGGGATT
TGTTGCAGAAGAAAGAAAGCATTACACTGTTTATCCACCCCCACACCAAGTCTTCACCTGGACCCAGATG
TGTGACATAAAAGATGTGAAGGTTGTCATCCTGGGACAGGATCCATATCATGGACCTAATCAAGCTCACG
GGCTCTGCTTTAGTGTTCAAAGGCCTGTTCCGCCTCCGCCCAGTTTGGAGAACATTTATAAAGAGTTGTC
TACAGACATAGAGGATTTTGTTCATCCTGGCCATGGAGATTTATCTGGGTGGGCCAAGCAAGGTGTTCTC
CTTCTCAACGCTGTCCTCACGGTTCGTGCCCATCAAGCCAACTCTCATAAGGAGCGAGGCTGGGAGCAGT
TCACTGATGCAGTTGTGTCCTGGCTAAATCAGAACTCGAATGGCCTTGTTTTCTTGCTCTGGGGCTCTTA
TGCTCAGAAGAAGGGCAGTGCCATTGATAGGAAGCGGCACCATGTACTACAGACGGCTCATCCCTCCCCT
TTGTCAGTGTATAGAGGGTTCTTTGGATGTAGACACTTTTCAAAGACCAATGAGCTGCTGCAGAAGTCTG
GCAAGAAGCCCATTGACTGGAAGGAGCTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG222868 representing NM_080911
Red=Cloning site Green=Tags(s)

MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQ
LDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQM
CDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVL
LLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSP
LSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_080911
ORF Size 939 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_080911.3
RefSeq Size 2053 bp
RefSeq ORF 942 bp
Locus ID 7374
UniProt ID P13051
Cytogenetics 12q24.11
Domains UDG
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Base excision repair, Primary immunodeficiency
Gene Summary This gene encodes one of several uracil-DNA glycosylases. One important function of uracil-DNA glycosylases is to prevent mutagenesis by eliminating uracil from DNA molecules by cleaving the N-glycosylic bond and initiating the base-excision repair (BER) pathway. Uracil bases occur from cytosine deamination or misincorporation of dUMP residues. Alternative promoter usage and splicing of this gene leads to two different isoforms: the mitochondrial UNG1 and the nuclear UNG2. The UNG2 term was used as a previous symbol for the CCNO gene (GeneID 10309), which has been confused with this gene, in the literature and some databases. [provided by RefSeq, Nov 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.