Contactin 3(CNTN3) (NM_020872) Human Tagged ORF Clone

CAT#: RG221979

CNTN3 (GFP-tagged) - Human contactin 3 (plasmacytoma associated) (CNTN3)

Change vector?

  • TrueORF®

USD 917


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Contactin 3(CNTN3) (NM_020872) Human Tagged ORF Clone
Symbol CNTN3
Synonyms BIG-1; PANG; PCS
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG221979 representing NM_020872
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGTTTCCATGGAAACAGTTGATCCTGCTTTCATTCATTGGCTGCTTAGGAGGTGAGCTTCTCTTAC
AAGGCCCTGTATTTATCAAAGAACCCAGCAACAGCATTTTCCCTGTTGGTTCAGAAGATAAAAAAATAAC
TTTGCATTGTGAAGCAAGAGGCAATCCATCACCTCATTACAGATGGCAGCTGAATGGAAGTGATATTGAT
ATGAGTATGGAACATCGTTATAAGTTGAATGGAGGAAATCTTGTGGTTATTAATCCCAACAGAAATTGGG
ATACAGGAACTTACCAATGTTTTGCAACAAATTCACTTGGAACAATTGTCAGCAGAGAAGCCAAACTTCA
GTTTGCCTATCTTGAAAATTTTAAAACCAAAATGAGGAGTACAGTGTCTGTGCGTGAAGGCCAGGGAGTT
GTGCTGCTCTGCGGCCCCCCACCACACTCTGGAGAACTGTCATATGCTTGGATCTTCAATGAATACCCAT
CGTTTGTTGAAGAAGATAGTCGGAGATTTGTCTCCCAGGAGACAGGGCACCTCTACATATCTAAGGTGGA
GCCGTCTGATGTGGGAAATTACACATGTGTGGTGACAAGTATGGTGACAAATGCCCGAGTGCTGGGCTCT
CCAACTCCTTTGGTGCTACGTTCTGATGGTGTGATGGGTGAATATGAACCTAAAATAGAAGTTCAGTTTC
CAGAAACTCTTCCAGCAGCTAAAGGTTCGACTGTGAAATTGGAATGTTTTGCCCTTGGAAATCCCATACC
TCAGATTAATTGGAGAAGAAGTGATGGGCTGCCATTTTCCAGCAAAATTAAATTAAGGAAGTTCAGTGGT
GTGCTTGAAATCCCCAACTTCCAACAGGAAGATGCAGGTTCCTATGAATGCATTGCTGAGAATTCACGAG
GAAAAAATGTTGCCAGAGGGCGTCTCACTTACTATGCAAAGCCCCATTGGGTTCAACTCATAAAGGATGT
GGAAATAGCCGTGGAGGACAGTCTTTATTGGGAATGCAGGGCAAGCGGCAAGCCCAAGCCTTCCTACCGA
TGGCTGAAAAATGGAGCAGCCCTGGTGCTAGAGGAGAGAACACAGATAGAAAATGGTGCCCTTACAATAT
CAAACCTAAGTGTGACTGATTCTGGCATGTTCCAGTGCATAGCAGAAAACAAACATGGCCTTGTTTATTC
CAGTGCTGAGCTCAAAGTTGTTGCTTCTGCTCCAGATTTTTCAAAGAATCCAATGAAGAAGTTGGTTCAG
GTGCAGGTGGGCAGCCTGGTCAGCTTGGATTGTAAACCCAGAGCCTCCCCAAGGGCACTCTCTTCCTGGA
AGAAGGGGGATGTGAGCGTGCAGGAGCATGAAAGAATTTCTTTGTTAAACGATGGAGGACTCAAAATAGC
CAATGTGACTAAAGCTGATGCTGGAACTTACACCTGCATGGCAGAAAACCAGTTTGGGAAAGCAAATGGC
ACAACACATTTGGTTGTTACGGAACCAACAAGAATAACTTTGGCACCATCTAACATGGATGTTTCTGTTG
GTGAAAGCGTCATATTGCCCTGCCAGGTACAACATGACCCGCTGTTAGACATCATCTTTACCTGGTATTT
CAATGGGGCCCTTGCAGATTTTAAGAAAGATGGATCTCACTTTGAGAAAGTTGGTGGGAGTTCATCTGGT
GATTTAATGATCAGAAACATTCAGCTGAAACACAGTGGGAAATATGTTTGTATGGTGCAAACGGGGGTGG
ACAGTGTTTCATCTGCTGCTGACCTCATAGTAAGAGGTTCACCTGGACCACCAGAAAATGTGAAGGTAGA
TGAAATTACAGACACAACAGCCCAACTCTCTTGGAAAGAAGGTAAAGACAACCATAGCCCAGTTATATCC
TATTCTATCCAGGCTCGGACACCTTTCTCCGTGGGTTGGCAAACCGTCACAACAGTGCCTGAGGTCATCG
ATGGGAAGACGCACACAGCCACTGTAGTTGAGTTAAACCCATGGGTGGAATATGAATTTCGGGTTGTAGC
CAGTAACAAAATTGGAGGTGGAGAACCAAGTTTACCCTCAGAAAAAGTAAGAACTGAAGAGGCAGTTCCA
GAAGTGCCTCCTTCTGAAGTCAATGGAGGAGGCGGAAGCCGGTCTGAACTTGTGATAACCTGGGATCCAG
TCCCTGAAGAACTACAGAATGGTGAAGGTTTTGGGTATGTTGTTGCTTTCCGCCCTCTTGGGGTTACCAC
CTGGATCCAGACAGTGGTGACATCCCCTGACACCCCAAGATATGTCTTTAGGAATGAAAGCATCGTGCCA
TATTCACCATATGAAGTTAAAGTGGGTGTTTATAATAACAAAGGTGAAGGACCATTTAGCCCAGTGACAA
CAGTGTTCTCTGCAGAAGAAGAGCCTACAGTGGCCCCATCTCAAGTCTCTGCAAATAGCCTATCTTCCTC
AGAAATTGAGGTTTCATGGAACACCATTCCTTGGAAGTTGAGCAATGGACATTTACTGGGCTATGAGGTG
CGGTACTGGAATGGGGGTGGAAAGGAGGAATCATCCAGTAAGATGAAAGTGGCAGGAAATGAGACATCAG
CCAGACTACGGGGCCTGAAGAGCAACCTGGCCTATTACACGGCTGTCCGGGCTTACAACAGTGCCGGCGC
TGGGCCTTTTAGCGCCACAGTTAATGTAACCACCAAGAAAACGCCTCCCAGTCAGCCACCAGGAAATGTT
GTTTGGAATGCCACAGACACTAAAGTGTTACTTAATTGGGAGCAAGTTAAAGCCATGGAGAATGAGTCAG
AAGTAACAGGATATAAAGTTTTCTATAGGACTAGCAGTCAAAATAACGTACAAGTACTGAACACAAATAA
AACTTCAGCTGAACTTGTGCTGCCCATTAAAGAGGACTACATTATTGAAGTCAAGGCCACAACAGATGGA
GGGGATGGGACCAGTAGTGAACAGATCAGGATTCCACGAATAACCAGTATGGATGCAAGAGGATCCACTT
CAGCCATCTCGAATGTCCACCCTATGTCAAGTTATATGCCTATAGTACTGTTCTTAATTGTATATGTCCT
GTGG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG221979 representing NM_020872
Red=Cloning site Green=Tags(s)

MMFPWKQLILLSFIGCLGGELLLQGPVFIKEPSNSIFPVGSEDKKITLHCEARGNPSPHYRWQLNGSDID
MSMEHRYKLNGGNLVVINPNRNWDTGTYQCFATNSLGTIVSREAKLQFAYLENFKTKMRSTVSVREGQGV
VLLCGPPPHSGELSYAWIFNEYPSFVEEDSRRFVSQETGHLYISKVEPSDVGNYTCVVTSMVTNARVLGS
PTPLVLRSDGVMGEYEPKIEVQFPETLPAAKGSTVKLECFALGNPIPQINWRRSDGLPFSSKIKLRKFSG
VLEIPNFQQEDAGSYECIAENSRGKNVARGRLTYYAKPHWVQLIKDVEIAVEDSLYWECRASGKPKPSYR
WLKNGAALVLEERTQIENGALTISNLSVTDSGMFQCIAENKHGLVYSSAELKVVASAPDFSKNPMKKLVQ
VQVGSLVSLDCKPRASPRALSSWKKGDVSVQEHERISLLNDGGLKIANVTKADAGTYTCMAENQFGKANG
TTHLVVTEPTRITLAPSNMDVSVGESVILPCQVQHDPLLDIIFTWYFNGALADFKKDGSHFEKVGGSSSG
DLMIRNIQLKHSGKYVCMVQTGVDSVSSAADLIVRGSPGPPENVKVDEITDTTAQLSWKEGKDNHSPVIS
YSIQARTPFSVGWQTVTTVPEVIDGKTHTATVVELNPWVEYEFRVVASNKIGGGEPSLPSEKVRTEEAVP
EVPPSEVNGGGGSRSELVITWDPVPEELQNGEGFGYVVAFRPLGVTTWIQTVVTSPDTPRYVFRNESIVP
YSPYEVKVGVYNNKGEGPFSPVTTVFSAEEEPTVAPSQVSANSLSSSEIEVSWNTIPWKLSNGHLLGYEV
RYWNGGGKEESSSKMKVAGNETSARLRGLKSNLAYYTAVRAYNSAGAGPFSATVNVTTKKTPPSQPPGNV
VWNATDTKVLLNWEQVKAMENESEVTGYKVFYRTSSQNNVQVLNTNKTSAELVLPIKEDYIIEVKATTDG
GDGTSSEQIRIPRITSMDARGSTSAISNVHPMSSYMPIVLFLIVYVLW

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_020872
ORF Size 3084 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_020872.1, NP_065923
RefSeq Size 4997
RefSeq ORF 3087
Locus ID 5067
Cytogenetics 3p12.3
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations