CUX1 (NM_181500) Human Tagged ORF Clone

CAT#: RG221942

CUX1 (GFP-tagged) - Human cut-like homeobox 1 (CUX1), transcript variant 3

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,144.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CUX1 (NM_181500) Human Tagged ORF Clone
Symbol CUX1
Synonyms CASP; CDP; CDP/Cut; CDP1; Clox; COY1; CUTL1; CUX; Cux/CDP; GOLIM6; Nbla10317; p100; p110; p200;
Vector pCMV6-AC-GFP
Sequence Data
>RG221942 representing NM_181500
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCCAATGTGGGATCGATGTTTCAATATTGGAAGCGCTTTGATTTACAGCAGCTGCAGAGAGAAC
TCGATGCCACCGCAACGGTATTGGCGAACCGGCAGGATGAAAGTGAGCAGTCCAGAAAGCGGCTTATCGA
ACAGAGCCGGGAGTTCAAGAAGAACACTCCAGAGGATTTGCGCAAGCAGGTAGCGCCGCTGCTGAAGAGT
TTCCAAGGAGAGATTGATGCACTGAGTAAAAGAAGCAAGGAAGCTGAAGCAGCTTTCTTGAATGTCTACA
AAAGATTGATTGACGTCCCAGATCCCGTACCAGCTTTGGATCTCGGACAGCAACTCCAGCTCAAAGTGCA
GCGCCTGCACGATATTGAAACAGAGAACCAGAAACTTAGGGAAACTCTGGAAGAATACAACAAGGAATTT
GCTGAAGTGAAAAATCAAGAGGTTACGATAAAAGCACTTAAAGAGAAAATCCGAGAATATGAACAGACAC
TGAAGAACCAAGCCGAAACCATAGCTCTTGAGAAGGAACAGAAGTTACAGAATGACTTTGCAGAAAAGGA
GAGAAAGCTGCAGGAGACACAGATGTCCACCACCTCAAAGCTGGAGGAAGCTGAGCATAAGGTTCAGAGC
CTACAAACAGCCCTGGAAAAAACTCGAACAGAATTATTTGACCTGAAAACCAAATACGATGAAGAAACTA
CTGCAAAGGCCGACGAGATTGAAATGATCATGACGGACCTTGAAAGGGCAAACCAGAGGGCAGAGGTGGC
TCAGAGAGAGGCGGAGACCTTAAGGGAACAGCTCTCATCGGCCAATCACTCCCTCCAGCTGGCCTCACAG
ATCCAGAAGGCACCAGACGTGGCCATAGAGGTGCTGACCCGCTCCAGCCTAGAAGTTGAGTTGGCCGCCA
AGGAGCGGGAGATCGCACAGCTGGTGGAGGACGTGCAGAGACTCCAGGCCAGCCTCACCAAGCTGCGGGA
GAATTCGGCCAGCCAGATCTCACAGCTTGAGCAGCAGCTGAGCGCCAAAAACAGCACACTCAAACAACTG
GAAGAAAAACTCAAAGGCCAGGCTGACTATGAAGAGGTGAAGAAAGAGCTGAACATTCTGAAGTCCATGG
AGTTTGCACCGTCCGAGGGCGCTGGGACACAGGATGCGGCCAAGCCCCTGGAGGTGCTGTTGCTGGAGAA
GAACCGCTCGCTGCAGTCCGAGAACGCCGCGCTGCGCATCTCCAACAGCGACCTGAGCGGACGCTGTGCA
GAGCTGCAAGTCCGTATCACTGAGGCTGTGGCCACAGCCACTGAGCAGAGAGAGCTGATCGCCCGCCTGG
AGCAGGACCTGAGCATCATTCAGTCCATCCAGCGGCCCGATGCCGAGGGTGCCGCTGAGCACCGCCTGGA
GAAGATCCCAGAGCCCATCAAAGAGGCCACTGCCCTATTCTACGGACCTGCAGCACCAGCCAGCGGTGCC
CTCCCAGAGGGCCAGGTGGATTCACTGCTTTCCATCATCTCCAGCCAGAGGGAGCGCTTCCGTGCCCGGA
ACCAGGAGCTTGAGGCCGAGAACCGCCTGGCCCAGCACACCCTCCAGGCCCTGCAGAGTGAGCTGGACAG
CCTGCGCGCCGACAACATCAAGCTCTTTGAGAAGATCAAGTTCCTGCAGAGCTACCCTGGCCGGGGCAGC
GGCAGTGATGACACGGAGCTGCGGTACTCGTCCCAGTACGAGGAGCGCCTGGACCCCTTCTCCTCCTTCA
GCAAGCGGGAGCGGCAGAGGAAGTACCTGAGCTTGAGTCCCTGGGACAAGGCCACCCTCAGCATGGGGCG
TCTGGTTCTCTCCAACAAGATGGCGCGCACCATCGGCTTCTTCTACACACTGTTCCTGCACTGCCTGGTC
TTCCTGGTGCTCTACAAGCTGGCATGGAGCGAGAGCATGGAGAGGGACTGTGCCACCTTCTGCGCCAAGA
AGTTCGCTGACCACCTGCACAAGTTCCACGAGAATGACAACGGGGCTGCGGCTGGTGACTTGTGGCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG221942 representing NM_181500
Red=Cloning site Green=Tags(s)

MAANVGSMFQYWKRFDLQQLQRELDATATVLANRQDESEQSRKRLIEQSREFKKNTPEDLRKQVAPLLKS
FQGEIDALSKRSKEAEAAFLNVYKRLIDVPDPVPALDLGQQLQLKVQRLHDIETENQKLRETLEEYNKEF
AEVKNQEVTIKALKEKIREYEQTLKNQAETIALEKEQKLQNDFAEKERKLQETQMSTTSKLEEAEHKVQS
LQTALEKTRTELFDLKTKYDEETTAKADEIEMIMTDLERANQRAEVAQREAETLREQLSSANHSLQLASQ
IQKAPDVAIEVLTRSSLEVELAAKEREIAQLVEDVQRLQASLTKLRENSASQISQLEQQLSAKNSTLKQL
EEKLKGQADYEEVKKELNILKSMEFAPSEGAGTQDAAKPLEVLLLEKNRSLQSENAALRISNSDLSGRCA
ELQVRITEAVATATEQRELIARLEQDLSIIQSIQRPDAEGAAEHRLEKIPEPIKEATALFYGPAAPASGA
LPEGQVDSLLSIISSQRERFRARNQELEAENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGS
GSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTIGFFYTLFLHCLV
FLVLYKLAWSESMERDCATFCAKKFADHLHKFHENDNGAAAGDLWQ

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_181500
ORF Size 2028 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_181500.1, NP_852477
RefSeq Size 2925
RefSeq ORF 2031
Locus ID 1523
Cytogenetics 7q22.1
Protein Families Transmembrane, Transcription Factors
Gene Summary The protein encoded by this gene is a member of the homeodomain family of DNA binding proteins. It may regulate gene expression, morphogenesis, and differentiation and it may also play a role in the cell cycle progession. Several alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Feb 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)