AKAP4 (NM_003886) Human Tagged ORF Clone

CAT#: RG221765

AKAP4 (GFP-tagged) - Human A kinase (PRKA) anchor protein 4 (AKAP4), transcript variant 1

Change vector?

  • TrueORF®

USD 629


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name AKAP4 (NM_003886) Human Tagged ORF Clone
Symbol AKAP4
Synonyms AKAP 82; AKAP-4; AKAP82; CT99; FSC1; hAKAP82; HI; p82; PRKA4
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG221765 representing NM_003886
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGGCGTACTCTGATACTACAATGATGTCTGATGATATTGACTGGTTACGCAGCCACAGGGGTGTGT
GCAAGGTAGATCTCTACAACCCAGAAGGACAGCAAGATCAGGACCGGAAAGTGATATGCTTTGTCGATGT
GTCCACCCTGAATGTAGAAGATAAAGATTACAAGGATGCTGCTAGTTCCAGCTCAGAAGGCAACTTAAAC
CTGGGAAGTCTGGAAGAAAAAGAGATTATCGTGATCAAGGACACTGAGAAGAAAGACCAGTCTAAGACAG
AGGGATCTGTATGCCTTTTCAAACAAGCTCCCTCTGATCCTGTAAGTGTCCTCAACTGGCTTCTCAGTGA
TCTCCAGAAGTATGCCTTGGGTTTCCAACATGCACTGAGCCCCTCAACCTCTACCTGTAAACATAAAGTA
GGAGACACAGAGGGCGAATATCACAGAGCATCCTCTGAGAACTGCTACAGTGTCTATGCCGATCAAGTGA
ACATAGATTATTTGATGAACAGACCTCAAAACCTACGTCTAGAAATGACAGCAGCTAAAAACACCAACAA
TAATCAAAGTCCTTCAGCTCCTCCAGCCAAACCTCCTAGCACTCAGAGAGCAGTCATTTCCCCTGATGGA
GAATGTTCTATAGATGACCTTTCCTTCTACGTCAACCGACTATCTTCTCTGGTAATCCAGATGGCCCATA
AGGAAATCAAGGAGAAGTTGGAAGGTAAAAGCAAATGCCTTCATCATTCAATCTGTCCATCCCCTGGGAA
CAAAGAGAGAATCAGTCCCCGAACTCCTGCGAGCAAGATTGCTTCTGAAATGGCCTATGAAGCTGTGGAA
CTGACAGCTGCAGAAATGCGTGGCACTGGAGAGGAGTCCAGGGAAGGTGGCCAGAAAAGCTTTCTATATA
GCGAATTATCCAACAAGAGCAAAAGTGGAGACAAACAGATGTCCCAGAGAGAGAGCAAAGAATTTGCAGA
TTCCATCAGCAAGGGGCTCATGGTTTATGCAAATCAGGTGGCATCTGACATGATGGTCTCTCTCATGAAG
ACCTTGAAAGTGCACAGCTCTGGGAAGCCAATTCCAGCATCTGTGGTCCTGAAGAGGGTGTTGCTAAGGC
ACACCAAGGAGATTGTGTCCGATTTGATTGATTCTTGCATGAAGAACCTGCATAATATTACTGGGGTCCT
GATGACTGACTCAGACTTTGTCTCAGCTGTCAAGAGAAATCTGTTCAACCAGTGGAAACAAAATGCTACA
GACATCATGGAGGCCATGCTGAAGCGCTTGGTCAGTGCCCTTATAGGTGAGGAGAAGGAGACTAAGTCTC
AGAGTCTGTCATATGCATCTTTAAAAGCTGGGTCCCATGATCCCAAATGCAGGAATCAGAGTCTTGAATT
CTCCACCATGAAAGCTGAAATGAAAGAGAGGGACAAAGGCAAAATGAAATCAGACCCATGCAAGTCACTG
ACTAGTGCTGAGAAAGTCGGTGAACACATTCTCAAAGAGGGCCTAACCATCTGGAACCAAAAGCAAGGAA
ACTCATGCAAGGTGGCTACCAAAGCATGCAGCAATAAAGATGAGAAAGGAGAAAAGATCAATGCTTCCAC
AGATTCACTGGCCAAGGACCTGATTGTCTCTGCCCTTAAGCTGATCCAGTACCATCTGACCCAGCAGACT
AAGGGCAAAGATACATGTGAAGAAGACTGTCCTGGTTCCACCATGGGCTATATGGCTCAGAGTACTCAAT
ATGAAAAGTGTGGAGGTGGCCAAAGTGCCAAAGCACTTTCAGTGAAACAACTAGAATCTCACAGAGCCCC
TGGACCATCCACCTGTCAAAAGGAGAACCAACACCTGGACTCCCAGAAAATGGATATGTCAAACATCGTT
CTAATGCTGATTCAGAAACTGCTTAATGAGAACCCCTTCAAATGTGAGGATCCATGCGAAGGTGAGAACA
AGTGTTCTGAGCCCAGGGCAAGCAAAGCAGCTTCCATGTCCAACAGATCTGACAAAGCGGAAGAACAATG
CCAGGAGCATCAAGAACTTGACTGTACCAGTGGGATGAAGCAAGCGAACGGGCAATTTATAGATAAACTA
GTAGAATCTGTGATGAAGCTCTGCCTTATCATGGCTAAGTATAGCAACGATGGGGCAGCCCTTGCTGAGT
TGGAAGAACAAGCAGCCTCGGCAAATAAGCCCAATTTCAGGGGCACCAGATGCATTCACAGTGGTGCAAT
GCCACAGAACTATCAAGACTCTCTTGGACATGAAGTAATTGTCAATAATCAGTGCTCTACAAATAGCTTG
CAGAAGCAGCTCCAGGCTGTCCTGCAGTGGATTGCAGCCTCCCAGTTTAACGTGCCCATGCTCTACTTCA
TGGGAGATAAGGATGGACAACTGGAAAAGCTTCCTCAGGTTTCAGCTAAAGCAGCAGAGAAGGGGTACAG
TGTAGGAGGTCTTCTTCAAGAGGTCATGAAGTTTGCCAAGGAACGGCAACCAGATGAAGCTGTGGGAAAG
GTGGCCAGGAAACAGTTGCTGGACTGGCTGCTCGCTAACCTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG221765 representing NM_003886
Red=Cloning site Green=Tags(s)

MMAYSDTTMMSDDIDWLRSHRGVCKVDLYNPEGQQDQDRKVICFVDVSTLNVEDKDYKDAASSSSEGNLN
LGSLEEKEIIVIKDTEKKDQSKTEGSVCLFKQAPSDPVSVLNWLLSDLQKYALGFQHALSPSTSTCKHKV
GDTEGEYHRASSENCYSVYADQVNIDYLMNRPQNLRLEMTAAKNTNNNQSPSAPPAKPPSTQRAVISPDG
ECSIDDLSFYVNRLSSLVIQMAHKEIKEKLEGKSKCLHHSICPSPGNKERISPRTPASKIASEMAYEAVE
LTAAEMRGTGEESREGGQKSFLYSELSNKSKSGDKQMSQRESKEFADSISKGLMVYANQVASDMMVSLMK
TLKVHSSGKPIPASVVLKRVLLRHTKEIVSDLIDSCMKNLHNITGVLMTDSDFVSAVKRNLFNQWKQNAT
DIMEAMLKRLVSALIGEEKETKSQSLSYASLKAGSHDPKCRNQSLEFSTMKAEMKERDKGKMKSDPCKSL
TSAEKVGEHILKEGLTIWNQKQGNSCKVATKACSNKDEKGEKINASTDSLAKDLIVSALKLIQYHLTQQT
KGKDTCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIV
LMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQANGQFIDKL
VESVMKLCLIMAKYSNDGAALAELEEQAASANKPNFRGTRCIHSGAMPQNYQDSLGHEVIVNNQCSTNSL
QKQLQAVLQWIAASQFNVPMLYFMGDKDGQLEKLPQVSAKAAEKGYSVGGLLQEVMKFAKERQPDEAVGK
VARKQLLDWLLANL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_003886
ORF Size 2562 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003886.2, NP_003877
RefSeq Size 2881
RefSeq ORF 2565
Locus ID 8852
Cytogenetics Xp11.22
Protein Families Druggable Genome
Gene Summary The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is localized to the sperm flagellum and may be involved in the regulation of sperm motility. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations