CPT1A (NM_001876) Human Tagged ORF Clone

CAT#: RG221740

CPT1A (GFP-tagged) - Human carnitine palmitoyltransferase 1A (liver) (CPT1A), nuclear gene encoding mitochondrial protein, transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,298.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CPT1A (NM_001876) Human Tagged ORF Clone
Symbol CPT1A
Synonyms CPT1; CPT1-L; L-CPT1
Vector pCMV6-AC-GFP
Sequence Data
>RG221740 representing NM_001876
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGAAGCTCACCAAGCTGTGGCCTTTCAGTTCACGGTCACTCCGGACGGGATTGACCTGCGGCTGA
GCCATGAAGCTCTTAGACAAATCTATCTCTCTGGACTTCATTCCTGGAAAAAGAAGTTCATCAGATTCAA
GAACGGCATCATCACTGGCGTGTACCCGGCAAGCCCCTCCAGTTGGCTTATCGTGGTGGTGGGCGTGATG
ACAACGATGTACGCCAAGATCGACCCCTCGTTAGGAATAATTGCAAAAATCAATCGGACTCTGGAAACGG
CCAACTGCATGTCCAGCCAGACGAAGAACGTGGTCAGCGGCGTGCTGTTTGGCACCGGCCTGTGGGTGGC
CCTCATCGTCACCATGCGCTACTCCCTGAAAGTGCTGCTCTCCTACCACGGGTGGATGTTCACTGAGCAC
GGCAAGATGAGTCGTGCCACCAAGATCTGGATGGGTATGGTCAAGATCTTTTCAGGCCGAAAACCCATGT
TGTACAGCTTCCAGACATCGCTGCCTCGCCTGCCGGTCCCGGCTGTCAAAGACACTGTGAACAGGTATCT
ACAGTCGGTGAGGCCTCTTATGAAGGAAGAAGACTTCAAACGGATGACAGCACTTGCTCAAGATTTTGCT
GTCGGTCTTGGACCAAGATTACAGTGGTATTTGAAGTTAAAATCCTGGTGGGCTACAAATTACGTGAGCG
ACTGGTGGGAGGAGTACATCTACCTCCGAGGACGAGGGCCGCTCATGGTGAACAGCAACTATTATGCCAT
GGATCTGCTGTATATCCTTCCAACTCACATTCAGGCAGCAAGAGCCGGCAACGCCATCCATGCCATCCTG
CTTTACAGGCGCAAACTGGACCGGGAGGAAATCAAACCAATTCGTCTTTTGGGATCCACGATTCCACTCT
GCTCCGCTCAGTGGGAGCGGATGTTTAATACTTCCCGGATCCCAGGAGAGGAGACAGACACCATCCAGCA
CATGAGAGACAGCAAGCACATCGTCGTGTACCATCGAGGACGCTACTTCAAGGTCTGGCTCTACCATGAT
GGGCGGCTGCTGAAGCCCCGGGAGATGGAGCAGCAGATGCAGAGGATCCTGGACAATACCTCGGAGCCTC
AGCCCGGGGAGGCCAGGCTGGCAGCCCTCACCGCAGGAGACAGAGTTCCCTGGGCCAGGTGTCGTCAGGC
CTATTTTGGACGTGGGAAAAATAAGCAGTCTCTTGATGCTGTGGAGAAAGCAGCGTTCTTCGTGACGTTA
GATGAAACTGAAGAAGGATACAGAAGTGAAGACCCGGATACGTCAATGGACAGCTACGCCAAATCTCTAC
TACACGGCCGATGTTACGACAGGTGGTTTGACAAGTCGTTCACGTTTGTTGTCTTCAAAAACGGGAAGAT
GGGCCTCAACGCTGAACACTCCTGGGCAGATGCGCCGATCGTGGCCCACCTTTGGGAGTACGTCATGTCC
ATTGACAGCCTCCAGCTGGGCTATGCGGAGGATGGGCACTGCAAAGGCGACATCAATCCGAACATTCCGT
ACCCCACCAGGCTGCAGTGGGACATCCCGGGGGAATGTCAAGAGGTTATAGAGACCTCCCTGAACACCGC
AAATCTTCTGGCAAACGACGTGGATTTCCATTCCTTCCCATTCGTAGCCTTTGGTAAAGGAATCATCAAG
AAATGTCGCACGAGCCCAGACGCCTTTGTGCAGCTGGCCCTCCAGCTGGCGCACTACAAGGACATGGGCA
AGTTTTGCCTCACATACGAGGCCTCCATGACCCGGCTCTTCCGAGAGGGGAGGACGGAGACCGTGCGCTC
CTGCACCACTGAGTCATGCGACTTCGTGCGGGCCATGGTGGACCCGGCCCAGACGGTGGAACAGAGGCTG
AAGTTGTTCAAGTTGGCGTCTGAGAAGCATCAGCATATGTATCGCCTCGCCATGACCGGCTCTGGGATCG
ATCGTCACCTCTTCTGCCTTTACGTGGTGTCTAAATATCTCGCTGTGGAGTCCCCTTTCCTTAAGGAAGT
TTTATCTGAGCCTTGGAGATTATCAACAAGCCAGACCCCTCAGCAGCAAGTGGAGCTGTTTGACTTGGAG
AATAACCCAGAGTACGTGTCCAGCGGAGGGGGCTTTGGACCGGTTGCTGATGACGGCTATGGTGTGTCGT
ACATCCTTGTGGGAGAGAACCTCATCAATTTCCACATTTCTTCCAAGTTCTCTTGCCCTGAGACGGATTC
TCATCGCTTTGGAAGGCACCTGAAAGAAGCAATGACTGACATCATCACTTTGTTTGGTCTCAGTTCTAAT
TCCAAAAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG221740 representing NM_001876
Red=Cloning site Green=Tags(s)

MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKKFIRFKNGIITGVYPASPSSWLIVVVGVM
TTMYAKIDPSLGIIAKINRTLETANCMSSQTKNVVSGVLFGTGLWVALIVTMRYSLKVLLSYHGWMFTEH
GKMSRATKIWMGMVKIFSGRKPMLYSFQTSLPRLPVPAVKDTVNRYLQSVRPLMKEEDFKRMTALAQDFA
VGLGPRLQWYLKLKSWWATNYVSDWWEEYIYLRGRGPLMVNSNYYAMDLLYILPTHIQAARAGNAIHAIL
LYRRKLDREEIKPIRLLGSTIPLCSAQWERMFNTSRIPGEETDTIQHMRDSKHIVVYHRGRYFKVWLYHD
GRLLKPREMEQQMQRILDNTSEPQPGEARLAALTAGDRVPWARCRQAYFGRGKNKQSLDAVEKAAFFVTL
DETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMS
IDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIK
KCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRL
KLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLE
NNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPETDSHRFGRHLKEAMTDIITLFGLSSN
SKK

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001876
ORF Size 2319 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001876.2, NP_001867
RefSeq Size 2941
RefSeq ORF 2322
Locus ID 1374
Cytogenetics 11q13.3
Domains Carn_acyltransf
Protein Families Transmembrane, Druggable Genome
Protein Pathways Fatty acid metabolism, PPAR signaling pathway, Adipocytokine signaling pathway
Gene Summary The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)