DMRT2 (NM_006557) Human Tagged ORF Clone

CAT#: RG221391

  • TrueORF®

DMRT2 (tGFP-tagged) - Human doublesex and mab-3 related transcription factor 2 (DMRT2), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_006557" in other vectors (4)

Reconstitution Protocol

USD 680.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


Rabbit Polyclonal Anti-DMRT2 Antibody
    • 100 ul

USD 485.00

Other products for "DMRT2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol DMRT2
Synonyms DSXL-2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG221391 representing NM_006557
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGACCCGCAGGCTGGCTCCGCGGCCGGGGACTGGGAGATCGATGTCGAGAGCCTGGAGCTGGAAG
AGGACGTCTGCGGGGCGCCGCGGTCCACGCCCCCCGGGCCCAGCCCGCCGCCGGCGGACGGGGACTGCGA
GGACGACGAAGATGACGACGGGGTGGACGAAGACGCGGAAGAAGAGGGCGACGGCGAGGAGGCAGGCGCG
TCCCCCGGGATGCCCGGCCAGCCGGAGCAGCGGGGGGGACCGCAGCCGAGGCCGCCGCTCGCGCCTCAGG
CCTCACCCGCCGGCACCGGTCCCCGAGAGCGCTGCACTCCCGCGGGCGGCGGCGCGGAGCCGCGCAAGCT
GAGCCGCACGCCCAAGTGCGCGCGCTGCCGCAACCACGGCGTGGTGTCCTGCCTGAAGGGCCACAAGCGC
TTCTGTCGCTGGCGCGACTGCCAGTGCGCCAACTGCCTGCTGGTGGTGGAGCGGCAGCGCGTCATGGCCG
CCCAGGTGGCGCTCCGGAGGCAGCAGGCCACCGAGGACAAGAAGGGGCTTTCCGGGAAACAGAATAATTT
CGAGCGCAAAGCTGTGTACCAGAGGCAAGTCAGAGCCCCCAGTTTGCTGGCCAAAAGCATTTTAGAAGTT
CTCCTTGGATTATTCTACAGCTATTATGTGTACATAATGAACCATCTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG221391 representing NM_006557
Red=Cloning site Green=Tags(s)

MADPQAGSAAGDWEIDVESLELEEDVCGAPRSTPPGPSPPPADGDCEDDEDDDGVDEDAEEEGDGEEAGA
SPGMPGQPEQRGGPQPRPPLAPQASPAGTGPRERCTPAGGGAEPRKLSRTPKCARCRNHGVVSCLKGHKR
FCRWRDCQCANCLLVVERQRVMAAQVALRRQQATEDKKGLSGKQNNFERKAVYQRQVRAPSLLAKSILEV
LLGLFYSYYVYIMNHL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006557
ORF Size 678 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006557.7
RefSeq Size 2944 bp
RefSeq ORF 681 bp
Locus ID 10655
UniProt ID Q9Y5R5
Cytogenetics 9p24.3
Protein Families Transcription Factors, Transmembrane
Gene Summary The protein encoded by this gene belongs to the DMRT gene family, sharing a DM DNA-binding domain with Drosophila 'doublesex' (dsx) and C. elegans mab3, genes involved in sex determination in these organisms. Also, this gene is located in a region of the human genome (chromosome 9p24.3) associated with gonadal dysgenesis and XY sex reversal. Hence this gene is one of the candidates for sex-determining gene(s) on chr 9. [provided by RefSeq, Apr 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.