GTDC1 (NM_001006636) Human Tagged ORF Clone

CAT#: RG221336

GTDC1 (GFP-tagged) - Human glycosyltransferase-like domain containing 1 (GTDC1), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 649.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GTDC1 (NM_001006636) Human Tagged ORF Clone
Symbol GTDC1
Synonyms Hmat-Xa; mat-Xa
Vector pCMV6-AC-GFP
Sequence Data
>RG221336 representing NM_001006636
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTATCCTCATCATTGAAGCATTCTATGGAGGCTCCCATAAACAGCTGGTGGATCTTCTTCAAGAAG
AGTTAGGAGACTGTGTCGTTTATACCCTTCCTGCAAAGAAATGGCATTGGAGAGCCCGGACATCTGCTTT
ATATTTCTCTCAGACCATTCCCATCAGTGAGCATTACAGGACCCTCTTTGCAAGTTCAGTGCTTAACCTG
ACCGAACTGGCTGCCCTTCGGCCTGACCTTGGGAAACTGAAAAAGATTCTGTATTTTCACGAGAACCAGT
TGATATATCCTGTCAAGAAATGTCAGGAGAGGGATTTCCAATATGGATACAACCAAATTCTTTCATGCCT
GGTGGCTGATGTGGTTGTATTCAACTCAGTTTTTAATATGGAATCATTTCTCACTTCCATGGGAAAATTT
ATGAAGCTGATTCCTGATCACAGACCCAAGGATCTGGAAAGCATCATCAGACCCAAGTGCCAAGTTATTT
ACTTTCCCATCAGGTTTCCTGATGTGAGCAGATTCATGCCCAAGCACAAAACAACCCATTTAAAGAAGAT
GCTCGGCCTTAAAGGAAATGGCGGTGCGGTTCTGTCCATGGCCCTTCCTTTTCAGCCAGAGCAGAGAGAT
TCAGAGGATTTATTGAAGAATTTTAATTCAGAGTGTGATACACACTGTGGCCTTGATACTGCACGACAAG
AATATTTGGGTAACTCATTAAGACAGGAATCAGACTTGAAAAAATCCACCTCGTCAGATAATTCAAGCTC
TCATCATGGTGAAAATAAACAAAATCTGACTGTTGATCCCTGTGACATTTTGGGTGGAGTTGATAATCAG
CAAAGACTGCTACACATTGTCTGGCCTCACAGGTGGGAGCATGATAAAGATCCAGAAAGCTTTTTTAAGG
TATTAATGCATCTTAAAGACTTAGGACTCAATTTCCACGTGTCTGTACTTGGAGAAACCTTCACAGATGT
CCCAGATATTTTTTCAGAGGCCAAAAAGGCATTGGGATCTTCTGTCTTACACTGGGGCTACTTACCCAGC
AAAGATGACTATTTCCAAGTACTGTGCATGGCTGATGTTGTCATCTCAACAGCTAAGCATGAATTCTTTG
GAGTGGCAATGTTGGAAGCTGTGTACTGTGGGTGTTACCCACTTTGTCCTAAAGATTTGGTTTATCCCGA
AATATTTCCAGCTGAATATCTGTATTCTACACCTGAACAGCTTTCAAAAAGGCTCCAGAATTTCTGCAAG
AGACCAGATATTATAAGAAAACATCTCTATAAGGGTGAAATCGCTCCGTTTTCTTGGGCAGCCCTACATG
GTAAATTCAGGTCTCTGCTTACAACAGAACCTAGGGAAGATTTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG221336 representing NM_001006636
Red=Cloning site Green=Tags(s)

MSILIIEAFYGGSHKQLVDLLQEELGDCVVYTLPAKKWHWRARTSALYFSQTIPISEHYRTLFASSVLNL
TELAALRPDLGKLKKILYFHENQLIYPVKKCQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKF
MKLIPDHRPKDLESIIRPKCQVIYFPIRFPDVSRFMPKHKTTHLKKMLGLKGNGGAVLSMALPFQPEQRD
SEDLLKNFNSECDTHCGLDTARQEYLGNSLRQESDLKKSTSSDNSSSHHGENKQNLTVDPCDILGGVDNQ
QRLLHIVWPHRWEHDKDPESFFKVLMHLKDLGLNFHVSVLGETFTDVPDIFSEAKKALGSSVLHWGYLPS
KDDYFQVLCMADVVISTAKHEFFGVAMLEAVYCGCYPLCPKDLVYPEIFPAEYLYSTPEQLSKRLQNFCK
RPDIIRKHLYKGEIAPFSWAALHGKFRSLLTTEPREDL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001006636
ORF Size 1374 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001006636.1, NP_001006637
RefSeq Size 2692
RefSeq ORF 1377
Locus ID 79712
Cytogenetics 2q22.3
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)