Progesterone Receptor(PGR) (NM_000926) Human Tagged ORF Clone

CAT#: RG221303

PGR (GFP-tagged) - Human progesterone receptor (PGR), transcript variant 2

Change vector?

  • TrueORF®

USD 1,556.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Progesterone Receptor(PGR) (NM_000926) Human Tagged ORF Clone
Symbol PGR
Synonyms NR3C3; PR
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG221303 representing NM_000926
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTGAGCTGAAGGCAAAGGGTCCCCGGGCTCCCCACGTGGCGGGCGGCCCGCCCTCCCCCGAGGTCG
GATCCCCACTGCTGTGTCGCCCAGCCGCAGGTCCGTTCCCGGGGAGCCAGACCTCGGACACCTTGCCTGA
AGTTTCGGCCATACCTATCTCCCTGGACGGGCTACTCTTCCCTCGGCCCTGCCAGGGACAGGACCCCTCC
GACGAAAAGACGCAGGACCAGCAGTCGCTGTCGGACGTGGAGGGCGCATATTCCAGAGCTGAAGCTACAA
GGGGTGCTGGAGGCAGCAGTTCTAGTCCCCCAGAAAAGGACAGCGGACTGCTGGACAGTGTCTTGGACAC
TCTGTTGGCGCCCTCAGGTCCCGGGCAGAGCCAACCCAGCCCTCCCGCCTGCGAGGTCACCAGCTCTTGG
TGCCTGTTTGGCCCCGAACTTCCCGAAGATCCACCGGCTGCCCCCGCCACCCAGCGGGTGTTGTCCCCGC
TCATGAGCCGGTCCGGGTGCAAGGTTGGAGACAGCTCCGGGACGGCAGCTGCCCATAAAGTGCTGCCCCG
GGGCCTGTCACCAGCCCGGCAGCTGCTGCTCCCGGCCTCTGAGAGCCCTCACTGGTCCGGGGCCCCAGTG
AAGCCGTCTCCGCAGGCCGCTGCGGTGGAGGTTGAGGAGGAGGATAGCTCTGAGTCCGAGGAGTCTGCGG
GTCCGCTTCTGAAGGGCAAACCTCGGGCTCTGGGTGGCGCGGCGGCTGGAGGAGGAGCCGCGGCTTGTCC
GCCGGGGGCGGCAGCAGGAGGCGTCGCCCTGGTCCCCAAGGAAGATTCCCGCTTCTCAGCGCCCAGGGTC
GCCCTGGTGGAGCAGGACGCGCCGATGGCGCCCGGGCGCTCCCCGCTGGCCACCACGGTGATGGATTTCA
TCCACGTGCCTATCCTGCCTCTCAATCACGCCTTATTGGCAGCCCGCACTCGGCAGCTGCTGGAAGACGA
AAGTTACGACGGCGGGGCCGGGGCTGCCAGCGCCTTTGCCCCGCCGCGGACTTCACCCTGTGCCTCGTCC
ACCCCGGTCGCTGTAGGCGACTTCCCCGACTGCGCGTACCCGCCCGACGCCGAGCCCAAGGACGACGCGT
ACCCTCTCTATAGCGACTTCCAGCCGCCCGCTCTAAAGATAAAGGAGGAGGAGGAAGGCGCGGAGGCCTC
CGCGCGCTCCCCGCGTTCCTACCTTGTGGCCGGTGCCAACCCCGCAGCCTTCCCGGATTTCCCGTTGGGG
CCACCGCCCCCGCTGCCGCCGCGAGCGACCCCATCCAGACCCGGGGAAGCGGCGGTGACGGCCGCACCCG
CCAGTGCCTCAGTCTCGTCTGCGTCCTCCTCGGGGTCGACCCTGGAGTGCATCCTGTACAAAGCGGAGGG
CGCGCCGCCCCAGCAGGGCCCGTTCGCGCCGCCGCCCTGCAAGGCGCCGGGCGCGAGCGGCTGCCTGCTC
CCGCGGGACGGCCTGCCCTCCACCTCCGCCTCTGCCGCCGCCGCCGGGGCGGCCCCCGCGCTCTACCCTG
CACTCGGCCTCAACGGGCTCCCGCAGCTCGGCTACCAGGCCGCCGTGCTCAAGGAGGGCCTGCCGCAGGT
CTACCCGCCCTATCTCAACTACCTGAGGCCGGATTCAGAAGCCAGCCAGAGCCCACAATACAGCTTCGAG
TCATTACCTCAGAAGATTTGTTTAATCTGTGGGGATGAAGCATCAGGCTGTCATTATGGTGTCCTTACCT
GTGGGAGCTGTAAGGTCTTCTTTAAGAGGGCAATGGAAGGGCAGCACAACTACTTATGTGCTGGAAGAAA
TGACTGCATCGTTGATAAAATCCGCAGAAAAAACTGCCCAGCATGTCGCCTTAGAAAGTGCTGTCAGGCT
GGCATGGTCCTTGGAGGTCGAAAATTTAAAAAGTTCAATAAAGTCAGAGTTGTGAGAGCACTGGATGCTG
TTGCTCTCCCACAGCCATTGGGCGTTCCAAATGAAAGCCAAGCCCTAAGCCAGAGATTCACTTTTTCACC
AGGTCAAGACATACAGTTGATTCCACCACTGATCAACCTGTTAATGAGCATTGAACCAGATGTGATCTAT
GCAGGACATGACAACACAAAACCTGACACCTCCAGTTCTTTGCTGACAAGTCTTAATCAACTAGGCGAGA
GGCAACTTCTTTCAGTAGTCAAGTGGTCTAAATCATTGCCAGGTTTTCGAAACTTACATATTGATGACCA
GATAACTCTCATTCAGTATTCTTGGATGAGCTTAATGGTGTTTGGTCTAGGATGGAGATCCTACAAACAT
GTCAGTGGGCAGATGCTGTATTTTGCACCTGATCTAATACTAAATGAACAGCGGATGAAAGAATCATCAT
TCTATTCATTATGCCTTACCATGTGGCAGATCCCACAGGAGTTTGTCAAGCTTCAAGTTAGCCAAGAAGA
GTTCCTCTGTATGAAAGTATTGTTACTTCTTAATACAATTCCTTTGGAAGGGCTACGAAGTCAAACCCAG
TTTGAGGAGATGAGGTCAAGCTACATTAGAGAGCTCATCAAGGCAATTGGTTTGAGGCAAAAAGGAGTTG
TGTCGAGCTCACAGCGTTTCTATCAACTTACAAAACTTCTTGATAACTTGCATGATCTTGTCAAACAGCT
TCATCTGTACTGCTTGAATACATTTATCCAGTCCCGGGCACTGAGTGTTGAATTTCCAGAAATGATGTCT
GAAGTTATTGCTGCACAATTACCCAAGATATTGGCAGGGATGGTGAAACCCCTTCTCTTTCATAAAAAG


ACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG221303 representing NM_000926
Red=Cloning site Green=Tags(s)

MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPS
DEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLAPSGPGQSQPSPPACEVTSSW
CLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAAAHKVLPRGLSPARQLLLPASESPHWSGAPV
KPSPQAAAVEVEEEDSSESEESAGPLLKGKPRALGGAAAGGGAAACPPGAAAGGVALVPKEDSRFSAPRV
ALVEQDAPMAPGRSPLATTVMDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRTSPCASS
TPVAVGDFPDCAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLG
PPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPCKAPGASGCLL
PRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPPYLNYLRPDSEASQSPQYSFE
SLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQA
GMVLGGRKFKKFNKVRVVRALDAVALPQPLGVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIY
AGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKH
VSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQ
FEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMS
EVIAAQLPKILAGMVKPLLFHKK

TRPLE - GFP Tag - V
Restriction Sites SgfI-NotI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_000926
ORF Size 2799 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000926.2, NP_000917
RefSeq Size 5003
Locus ID 5241
Cytogenetics 11q22.1
Protein Families Nuclear Hormone Receptor, Transcription Factors, Druggable Genome
Protein Pathways Oocyte meiosis, Progesterone-mediated oocyte maturation
Gene Summary This gene encodes a member of the steroid receptor superfamily. The encoded protein mediates the physiological effects of progesterone, which plays a central role in reproductive events associated with the establishment and maintenance of pregnancy. This gene uses two distinct promotors and translation start sites in the first exon to produce several transcript variants, both protein coding and non-protein coding. Two of the isoforms (A and B) are identical except for an additional 165 amino acids found in the N-terminus of isoform B and mediate their own response genes and physiologic effects with little overlap. [provided by RefSeq, Sep 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.