EGR4 (NM_001965) Human Tagged ORF Clone

CAT#: RG221199

EGR4 (GFP-tagged) - Human early growth response 4 (EGR4)

Change vector?

  • TrueORF®

USD 835


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name EGR4 (NM_001965) Human Tagged ORF Clone
Symbol EGR4
Synonyms NGFI-C; NGFIC; PAT133
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG221199 representing NM_001965
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGTGGCCCGGGGAGTCGGAAGCCCGGAGCCAGCGCCGCCGCAGCTATATAAGTGGGGGGGCTGTG
GGCTGGGGGAGCCCGGCAGCGCTTTGGAGAGGCGAGGAGCCGCCGCCCGAGGCCGGTGCGGGCGAGCGAG
GGCGCCGCGGCTCCCCGACTCCTTTCCCAGAGGTGAGTGCCCGAAGCCAGGAGCCCGGGCGCCTAGGTCT
GTGCGCTGCGGGGAACCCCTACCGCCAGCCTCCCCGCCACCCGCGCGCCCCCAAGCCCAGCGGGCGAGGC
CCCGGGCGCCCCACAGCCGGCGCCGCGCCATGCTCCACCTTAGCGAGTTTTCCGAACCCGACGCGCTCCT
CGTCAAGTCCACTGAAGGCTGTTGCGCCGAACCCAGCGCTGAATTGCCCCGGCTGCCTGCCAGGGACGCT
CCCGCGGCCACCGGCTACCCTGGAGCAGGCGACTTCTTGAGCTGGGCTTTGAACAGCTGCGGCGCAAGTG
GGGACTTAGCCGACTCCTGCTTCCTGGAGGGGCCTGCGCCCACACCCCCTCCCGGCCTCAGCTACAGCGG
TAGCTTCTTCATTCAGGCAGTGCCCGAACACCCGCACGACCCGGAGGCACTCTTCAACCTCATGTCGGGC
ATCTTAGGCCTGGCACCCTTCCCCGGTCCAGAGGCAGCAGCGTCCAGATCCCCGCTGGATGCCCCTTTTC
CTGCGGGGTCCGATGCCTTGCTGCCGGGTCCGCCGGACCTTTACTCCCCGGATCTGGGCGCTGCCCCTTT
CCCAGAGGCGTTCTGGGAGGCCTCGCCTTGCGCGGGTGCCCCCTCGCAGTGCCTGTATGAGCCTCAGCTC
TCCCCGCCCGACGTCAAGCCCGGCCTCCGGGCGCCTCCCGCCTCGCCAGCGCTGGACGCTGTCTCTGCCT
TCAAGGGTCCCTACGCGCCCTGGGAGCTGCTTTCTGTGGGGGCCCCAGGGAACTGTGGGTCACAGGGAGA
CTACCAGGCCGCCCCGGAGGCTCGTTTTCCCGTAATAGGGACCAAGATTGAGGACTTGCTGTCCATCAGC
TGCCCTGCGGAACTGCCGGCCGTCCCAGCCAACAGACTCTATCCCAGCGGGGCCTATGACGCTTTCCCGC
TGGCCCCGGGTGACTTAGGGGAGGGGGCTGAGGGCCTCCCTGGGCTCCTGACCCCTCCTAGTGGGGAGGG
AGGGAGTAGCGGCGACGGCGGAGAGTTTCTGGCCAGTACGCAGCCTCAGCTTTCCCCGCTGGGCCTTCGC
AGCGCCGCCGCGGCGGACTTCCCTAAACCTCTGGTGGCGGACATCCCTGGAAGCAGTGGCGTGGCTGCAC
CACCCGTGCCGCCGCCGCCGCCCACCCCTTTCCCCCAGGCCAAGGCGCGACGCAAGGGGCGCCGCGGCGG
CAAATGCAGCACGCGCTGCTTCTGCCCGCGGCCGCACGCCAAGGCCTTCGCTTGCCCGGTGGAGAGTTGT
GTGCGGAGCTTTGCGCGCTCCGACGAGCTCAATCGCCACCTGCGCATCCACACGGGCCACAAACCCTTCC
AGTGCCGCATCTGCCTCCGCAACTTCAGCCGCAGCGACCACCTCACCACGCACGTGCGCACCCACACCGG
CGAGAAGCCTTTTGCTTGCGACGTGTGCGGCCGCCGCTTCGCGCGCAGCGATGAGAAGAAACGGCACAGC
AAGGTGCACCTCAAGCAGAAGGCGCGCGCCGAGGAGCGGCTCAAGGGCCTCGGCTTTTACTCGCTGGGCC
TCTCCTTCGCTTCTCTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG221199 representing NM_001965
Red=Cloning site Green=Tags(s)

MAVARGVGSPEPAPPQLYKWGGCGLGEPGSALERRGAAARGRCGRARAPRLPDSFPRGECPKPGARAPRS
VRCGEPLPPASPPPARPQAQRARPRAPHSRRRAMLHLSEFSEPDALLVKSTEGCCAEPSAELPRLPARDA
PAATGYPGAGDFLSWALNSCGASGDLADSCFLEGPAPTPPPGLSYSGSFFIQAVPEHPHDPEALFNLMSG
ILGLAPFPGPEAAASRSPLDAPFPAGSDALLPGPPDLYSPDLGAAPFPEAFWEASPCAGAPSQCLYEPQL
SPPDVKPGLRAPPASPALDAVSAFKGPYAPWELLSVGAPGNCGSQGDYQAAPEARFPVIGTKIEDLLSIS
CPAELPAVPANRLYPSGAYDAFPLAPGDLGEGAEGLPGLLTPPSGEGGSSGDGGEFLASTQPQLSPLGLR
SAAAADFPKPLVADIPGSSGVAAPPVPPPPPTPFPQAKARRKGRRGGKCSTRCFCPRPHAKAFACPVESC
VRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRHS
KVHLKQKARAEERLKGLGFYSLGLSFASL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001965
ORF Size 1767 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001965.3, NP_001956
RefSeq Size 2379
RefSeq ORF 1770
Locus ID 1961
Cytogenetics 2p13.2
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations