EOMES(EOMES) (NM_005442) Human Tagged ORF Clone

CAT#: RG221014

EOMES (GFP-tagged) - Human eomesodermin (EOMES)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,154.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name EOMES(EOMES) (NM_005442) Human Tagged ORF Clone
Symbol EOMES
Synonyms TBR2; TBR2
Vector pCMV6-AC-GFP
Sequence Data
>RG221014 representing NM_005442
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGTTAGGGGAGCAGCTCTTGGTGAGCTCAGTGAACCTGCCTGGCGCGCACTTCTACCCGCTGGAGA
GTGCGCGAGGCGGCAGCGGCGGGAGCGCTGGCCACCTCCCCAGCGCGGCCCCCTCTCCTCAGAAGTTGGA
CTTAGACAAAGCGTCCAAGAAGTTTTCCGGCAGTCTCTCCTGCGAGGCGGTGAGCGGGGAGCCCGCAGCC
GCCAGCGCAGGGGCCCCCGCGGCCATGCTTAGTGACACCGACGCCGGGGACGCATTTGCCAGCGCTGCGG
CAGTGGCCAAGCCGGGGCCCCCGGACGGCCGCAAGGGCTCCCCCTGCGGGGAGGAGGAGCTGCCCTCCGC
CGCTGCAGCCGCCGCCGCCGCCGCCGCCGCGGCTGCGGCCACTGCGCGCTACTCCATGGACAGCCTGAGC
TCCGAGCGGTACTACCTCCAGTCCCCCGGTCCTCAGGGGTCGGAGCTGGCTGCGCCCTGCTCACTCTTCC
CGTACCAGGCGGCGGCTGGGGCGCCCCACGGACCTGTGTACCCGGCTCCTAACGGGGCGCGCTACCCCTA
CGGCTCCATGCTGCCCCCCGGCGGCTTCCCCGCGGCTGTGTGCCCACCCGGGAGGGCGCAGTTCGGCCCA
GGAGCCGGTGCGGGCAGTGGCGCGGGCGGTAGCAGCGGCGGGGGCGGCGGCCCGGGCACCTATCAGTACA
GCCAGGGGGCTCCGCTCTACGGGCCGTACCCTGGAGCCGCAGCGGCGGGATCTTGCGGAGGACTGGGGGG
CCTGGGGGTTCCAGGTTCTGGCTTCCGTGCCCACGTCTACCTGTGCAACCGGCCTCTGTGGCTCAAATTC
CACCGCCACCAAACTGAGATGATCATTACGAAACAGGGCAGGCGCATGTTTCCTTTCTTGAGCTTCAACA
TAAACGGACTCAATCCCACTGCCCACTACAATGTGTTCGTAGAGGTGGTGCTGGCGGACCCCAACCACTG
GCGCTTCCAGGGGGGCAAATGGGTGACCTGTGGCAAAGCCGACAATAACATGCAGGGCAACAAAATGTAT
GTTCACCCAGAGTCTCCTAATACTGGTTCCCACTGGATGAGACAGGAGATTTCATTCGGGAAATTAAAAC
TCACCAATAACAAAGGCGCAAATAACAACAACACCCAGATGATAGTCTTACAATCCTTACACAAATACCA
ACCCCGACTGCATATTGTTGAAGTTACAGAGGATGGCGTGGAGGACTTGAATGAGCCCTCAAAGACCCAG
ACTTTTACCTTCTCAGAAACGCAATTCATTGCAGTGACTGCCTACCAAAACACCGATATTACTCAACTAA
AGATTGATCATAACCCCTTTGCAAAAGGCTTCAGAGACAACTATGATTCATCCCATCAGATTGTCCCTGG
AGGTCGGTACGGCGTTCAATCCTTCTTCCCGGAGCCCTTTGTCAACACTTTACCTCAAGCCCGCTATTAT
AATGGCGAGAGAACCGTGCCACAGACCAACGGCCTCCTTTCACCCCAACAGAGCGAAGAGGTGGCCAACC
CTCCCCAGCGGTGGCTTGTCACGCCTGTCCAGCAACCTGGGACCAACAAACTAGACATCAGTTCCTATGA
ATCTGAATATACTTCTAGCACATTGCTCCCATATGGCATTAAATCCTTGCCCCTTCAGACATCCCATGCC
CTGGGGTATTACCCAGACCCAACCTTTCCTGCAATGGCAGGGTGGGGAGGTCGAGGTTCTTACCAGAGGA
AGATGGCAGCTGGACTACCATGGACCTCCAGAACAAGCCCCACTGTGTTCTCTGAAGATCAGCTCTCCAA
GGAGAAAGTGAAAGAGGAAATTGGCTCTTCTTGGATAGAGACACCCCCTTCCATCAAATCTCTAGATTCC
AATGATTCAGGAGTATACACCAGTGCTTGTAAGCGAAGGCGGCTGTCTCCTAGCAACTCCAGTAATGAAA
ATTCACCCTCCATAAAGTGTGAGGACATTAATGCTGAAGAGTATAGTAAAGACACCTCAAAAGGCATGGG
AGGGTATTATGCTTTTTACACAACTCCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG221014 representing NM_005442
Red=Cloning site Green=Tags(s)

MQLGEQLLVSSVNLPGAHFYPLESARGGSGGSAGHLPSAAPSPQKLDLDKASKKFSGSLSCEAVSGEPAA
ASAGAPAAMLSDTDAGDAFASAAAVAKPGPPDGRKGSPCGEEELPSAAAAAAAAAAAAAATARYSMDSLS
SERYYLQSPGPQGSELAAPCSLFPYQAAAGAPHGPVYPAPNGARYPYGSMLPPGGFPAAVCPPGRAQFGP
GAGAGSGAGGSSGGGGGPGTYQYSQGAPLYGPYPGAAAAGSCGGLGGLGVPGSGFRAHVYLCNRPLWLKF
HRHQTEMIITKQGRRMFPFLSFNINGLNPTAHYNVFVEVVLADPNHWRFQGGKWVTCGKADNNMQGNKMY
VHPESPNTGSHWMRQEISFGKLKLTNNKGANNNNTQMIVLQSLHKYQPRLHIVEVTEDGVEDLNEPSKTQ
TFTFSETQFIAVTAYQNTDITQLKIDHNPFAKGFRDNYDSSHQIVPGGRYGVQSFFPEPFVNTLPQARYY
NGERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNKLDISSYESEYTSSTLLPYGIKSLPLQTSHA
LGYYPDPTFPAMAGWGGRGSYQRKMAAGLPWTSRTSPTVFSEDQLSKEKVKEEIGSSWIETPPSIKSLDS
NDSGVYTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKGMGGYYAFYTTP

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_005442
ORF Size 2058 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005442.2, NP_005433
RefSeq Size 2756
RefSeq ORF 2061
Locus ID 8320
Cytogenetics 3p24.1
Domains T-box
Protein Families ES Cell Differentiation/IPS, Embryonic stem cells, Transcription Factors
Gene Summary This gene belongs to the TBR1 (T-box brain protein 1) sub-family of T-box genes that share the common DNA-binding T-box domain. The encoded protein is a transcription factor which is crucial for embryonic development of mesoderm and the central nervous system in vertebrates. The protein may also be necessary for the differentiation of effector CD8+ T cells which are involved in defense against viral infections. A similar gene disrupted in mice is shown to be essential during trophoblast development and gastrulation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)