JAK2 (NM_004972) Human Tagged ORF Clone

CAT#: RG220503

JAK2 (GFP-tagged) - Human Janus kinase 2 (JAK2)

Change vector?

  • TrueORF®

USD 1,896


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name JAK2 (NM_004972) Human Tagged ORF Clone
Symbol JAK2
Synonyms JTK10; THCYT3
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG220503 representing NM_004972
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAATGGCCTGCCTTACGATGACAGAAATGGAGGGAACATCCACCTCTTCTATATATCAGAATGGTG
ATATTTCTGGAAATGCCAATTCTATGAAGCAAATAGATCCAGTTCTTCAGGTGTATCTTTACCATTCCCT
TGGGAAATCTGAGGCAGATTATCTGACCTTTCCATCTGGGGAGTATGTTGCAGAAGAAATCTGTATTGCT
GCTTCTAAAGCTTGTGGTATCACACCTGTGTATCATAATATGTTTGCTTTAATGAGTGAAACAGAAAGGA
TCTGGTATCCACCCAACCATGTCTTCCATATAGATGAGTCAACCAGGCATAATGTACTCTACAGAATAAG
ATTTTACTTTCCTCGTTGGTATTGCAGTGGCAGCAACAGAGCCTATCGGCATGGAATATCTCGAGGTGCT
GAAGCTCCTCTTCTTGATGACTTTGTCATGTCTTACCTCTTTGCTCAGTGGCGGCATGATTTTGTGCACG
GATGGATAAAAGTACCTGTGACTCATGAAACACAGGAAGAATGTCTTGGGATGGCAGTGTTAGATATGAT
GAGAATAGCCAAAGAAAACGATCAAACCCCACTGGCCATCTATAACTCTATCAGCTACAAGACATTCTTA
CCAAAATGTATTCGAGCAAAGATCCAAGACTATCATATTTTGACAAGGAAGCGAATAAGGTACAGATTTC
GCAGATTTATTCAGCAATTCAGCCAATGCAAAGCCACTGCCAGAAACTTGAAACTTAAGTATCTTATAAA
TCTGGAAACTCTGCAGTCTGCCTTCTACACAGAGAAATTTGAAGTAAAAGAACCTGGAAGTGGTCCTTCA
GGTGAGGAGATTTTTGCAACCATTATAATAACTGGAAACGGTGGAATTCAGTGGTCAAGAGGGAAACATA
AAGAAAGTGAGACACTGACAGAACAGGATTTACAGTTATATTGCGATTTTCCTAATATTATTGATGTCAG
TATTAAGCAAGCAAACCAAGAGGGTTCAAATGAAAGCCGAGTTGTAACTATCCATAAGCAAGATGGTAAA
AATCTGGAAATTGAACTTAGCTCATTAAGGGAAGCTTTGTCTTTCGTGTCATTAATTGATGGATATTATA
GATTAACTGCAGATGCACATCATTACCTCTGTAAAGAAGTAGCACCTCCAGCCGTGCTTGAAAATATACA
AAGCAACTGTCATGGCCCAATTTCGATGGATTTTGCCATTAGTAAACTGAAGAAAGCAGGTAATCAGACT
GGACTGTATGTACTTCGATGCAGTCCTAAGGACTTTAATAAATATTTTTTGACTTTTGCTGTCGAGCGAG
AAAATGTCATTGAATATAAACACTGTTTGATTACAAAAAATGAGAATGAAGAGTACAACCTCAGTGGGAC
AAAGAAGAACTTCAGCAGTCTTAAAGATCTTTTGAATTGTTACCAGATGGAAACTGTTCGCTCAGACAAT
ATAATTTTCCAGTTTACTAAATGCTGTCCCCCAAAGCCAAAAGATAAATCAAACCTTCTAGTCTTCAGAA
CGAATGGTGTTTCTGATGTACCAACCTCACCAACATTACAGAGGCCTACTCATATGAACCAAATGGTGTT
TCACAAAATCAGAAATGAAGATTTGATATTTAATGAAAGCCTTGGCCAAGGCACTTTTACAAAGATTTTT
AAAGGCGTACGAAGAGAAGTAGGAGACTACGGTCAACTGCATGAAACAGAAGTTCTTTTAAAAGTTCTGG
ATAAAGCACACAGAAACTATTCAGAGTCTTTCTTTGAAGCAGCAAGTATGATGAGCAAGCTTTCTCACAA
GCATTTGGTTTTAAATTATGGAGTATGTGTCTGTGGAGACGAGAATATTCTGGTTCAGGAGTTTGTAAAA
TTTGGATCACTAGATACATATCTGAAAAAGAATAAAAATTGTATAAATATATTATGGAAACTTGAAGTTG
CTAAACAGTTGGCATGGGCCATGCATTTTCTAGAAGAAAACACCCTTATTCATGGGAATGTATGTGCCAA
AAATATTCTGCTTATCAGAGAAGAAGACAGGAAGACAGGAAATCCTCCTTTCATCAAACTTAGTGATCCT
GGCATTAGTATTACAGTTTTGCCAAAGGACATTCTTCAGGAGAGAATACCATGGGTACCACCTGAATGCA
TTGAAAATCCTAAAAATTTAAATTTGGCAACAGACAAATGGAGTTTTGGTACCACTTTGTGGGAAATCTG
CAGTGGAGGAGATAAACCTCTAAGTGCTCTGGATTCTCAAAGAAAGCTACAATTTTATGAAGATAGGCAT
CAGCTTCCTGCACCAAAGTGGGCAGAATTAGCAAACCTTATAAATAATTGTATGGATTATGAACCAGATT
TCAGGCCTTCTTTCAGAGCCATCATACGAGATCTTAACAGTTTGTTTACTCCAGATTATGAACTATTAAC
AGAAAATGACATGTTACCAAATATGAGGATAGGTGCCCTAGGGTTTTCTGGTGCCTTTGAAGACCGGGAT
CCTACACAGTTTGAAGAGAGACATTTGAAATTTCTACAGCAACTTGGCAAGGGTAATTTTGGGAGTGTGG
AGATGTGCCGGTATGACCCTCTACAGGACAACACTGGGGAGGTGGTCGCTGTAAAAAAGCTTCAGCATAG
TACTGAAGAGCACCTAAGAGACTTTGAAAGGGAAATTGAAATCCTGAAATCCCTACAGCATGACAACATT
GTAAAGTACAAGGGAGTGTGCTACAGTGCTGGTCGGCGTAATCTAAAATTAATTATGGAATATTTACCAT
ATGGAAGTTTACGAGACTATCTTCAAAAACATAAAGAACGGATAGATCACATAAAACTTCTGCAGTACAC
ATCTCAGATATGCAAGGGTATGGAGTATCTTGGTACAAAAAGGTATATCCACAGGGATCTGGCAACGAGA
AATATATTGGTGGAGAACGAGAACAGAGTTAAAATTGGAGATTTTGGGTTAACCAAAGTCTTGCCACAAG
ACAAAGAATACTATAAAGTAAAAGAACCTGGTGAAAGTCCCATATTCTGGTATGCTCCAGAATCACTGAC
AGAGAGCAAGTTTTCTGTGGCCTCAGATGTTTGGAGCTTTGGAGTGGTTCTGTATGAACTTTTCACATAC
ATTGAGAAGAGTAAAAGTCCACCAGCGGAATTTATGCGTATGATTGGCAATGACAAACAAGGACAGATGA
TCGTGTTCCATTTGATAGAACTTTTGAAGAATAATGGAAGATTACCAAGACCAGATGGATGCCCAGATGA
GATCTATATGATCATGACAGAATGCTGGAACAATAATGTAAATCAACGCCCCTCCTTTAGGGATCTAGCT
CTTCGAGTGGATCAAATAAGGGATAACATGGCTGGA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG220503 representing NM_004972
Red=Cloning site Green=Tags(s)

MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSGEYVAEEICIA
ASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYFPRWYCSGSNRAYRHGISRGA
EAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLGMAVLDMMRIAKENDQTPLAIYNSISYKTFL
PKCIRAKIQDYHILTRKRIRYRFRRFIQQFSQCKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPS
GEEIFATIIITGNGGIQWSRGKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGK
NLEIELSSLREALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIQSNCHGPISMDFAISKLKKAGNQT
GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNCYQMETVRSDN
IIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKIRNEDLIFNESLGQGTFTKIF
KGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGVCVCGDENILVQEFVK
FGSLDTYLKKNKNCINILWKLEVAKQLAWAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDP
GISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRH
QLPAPKWAELANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNI
VKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATR
NILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTY
IEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLA
LRVDQIRDNMAG

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_004972
ORF Size 3396 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004972.2, NP_004963
RefSeq Size 5097
RefSeq ORF 3399
Locus ID 3717
Cytogenetics 9p24.1
Domains B41, pkinase, SH2, TyrKc, S_TKc
Protein Families Protein Kinase, Druggable Genome
Protein Pathways Chemokine signaling pathway, Jak-STAT signaling pathway, Adipocytokine signaling pathway
Gene Summary This gene product is a protein tyrosine kinase involved in a specific subset of cytokine receptor signaling pathways. It has been found to be constituitively associated with the prolactin receptor and is required for responses to gamma interferon. Mice that do not express an active protein for this gene exhibit embryonic lethality associated with the absence of definitive erythropoiesis. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.