ErbB 4(ERBB4) (NM_001042599) Human Tagged ORF Clone

CAT#: RG220500

ERBB4 (GFP-tagged) - Human v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian) (ERBB4), transcript variant JM-a/CVT-2

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 917.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ErbB 4(ERBB4) (NM_001042599) Human Tagged ORF Clone
Symbol ERBB4
Synonyms ALS19; HER4; p180erbB4
Vector pCMV6-AC-GFP
Sequence Data
>RG220500 representing NM_001042599
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCCGGCGACAGGACTTTGGGTCTGGGTGAGCCTTCTCGTGGCGGCGGGGACCGTCCAGCCCAGCG
ATTCTCAGTCAGTGTGTGCAGGAACGGAGAATAAACTGAGCTCTCTCTCTGACCTGGAACAGCAGTACCG
AGCCTTGCGCAAGTACTATGAAAACTGTGAGGTTGTCATGGGCAACCTGGAGATAACCAGCATTGAGCAC
AACCGGGACCTCTCCTTCCTGCGGTCTGTTCGAGAAGTCACAGGCTACGTGTTAGTGGCTCTTAATCAGT
TTCGTTACCTGCCTCTGGAGAATTTACGCATTATTCGTGGGACAAAACTTTATGAGGATCGATATGCCTT
GGCAATATTTTTAAACTACAGAAAAGATGGAAACTTTGGACTTCAAGAACTTGGATTAAAGAACTTGACA
GAAATCCTAAATGGTGGAGTCTATGTAGACCAGAACAAATTCCTTTGTTATGCAGACACCATTCATTGGC
AAGATATTGTTCGGAACCCATGGCCTTCCAACTTGACTCTTGTGTCAACAAATGGTAGTTCAGGATGTGG
ACGTTGCCATAAGTCCTGTACTGGCCGTTGCTGGGGACCCACAGAAAATCATTGCCAGACTTTGACAAGG
ACGGTGTGTGCAGAACAATGTGACGGCAGATGCTACGGACCTTACGTCAGTGACTGCTGCCATCGAGAAT
GTGCTGGAGGCTGCTCAGGACCTAAGGACACAGACTGCTTTGCCTGCATGAATTTCAATGACAGTGGAGC
ATGTGTTACTCAGTGTCCCCAAACCTTTGTCTACAATCCAACCACCTTTCAACTGGAGCACAATTTCAAT
GCAAAGTACACATATGGAGCATTCTGTGTCAAGAAATGTCCACATAACTTTGTGGTAGATTCCAGTTCTT
GTGTGCGTGCCTGCCCTAGTTCCAAGATGGAAGTAGAAGAAAATGGGATTAAAATGTGTAAACCTTGCAC
TGACATTTGCCCAAAAGCTTGTGATGGCATTGGCACAGGATCATTGATGTCAGCTCAGACTGTGGATTCC
AGTAACATTGACAAATTCATAAACTGTACCAAGATCAATGGGAATTTGATCTTTCTAGTCACTGGTATTC
ATGGGGACCCTTACAATGCAATTGAAGCCATAGACCCAGAGAAACTGAACGTCTTTCGGACAGTCAGAGA
GATAACAGGTTTCCTGAACATACAGTCATGGCCACCAAACATGACTGACTTCAGTGTTTTTTCTAACCTG
GTGACCATTGGTGGAAGAGTACTCTATAGTGGCCTGTCCTTGCTTATCCTCAAGCAACAGGGCATCACCT
CTCTACAGTTCCAGTCCCTGAAGGAAATCAGCGCAGGAAACATCTATATTACTGACAACAGCAACCTGTG
TTATTATCATACCATTAACTGGACAACACTCTTCAGCACAATCAACCAGAGAATAGTAATCCGGGACAAC
AGAAAAGCTGAAAATTGTACTGCTGAAGGAATGGTGTGCAACCATCTGTGTTCCAGTGATGGCTGTTGGG
GACCTGGGCCAGACCAATGTCTGTCGTGTCGCCGCTTCAGTAGAGGAAGGATCTGCATAGAGTCTTGTAA
CCTCTATGATGGTGAATTTCGGGAGTTTGAGAATGGCTCCATCTGTGTGGAGTGTGACCCCCAGTGTGAG
AAGATGGAAGATGGCCTCCTCACATGCCATGGACCGGGTCCTGACAACTGTACAAAGTGCTCTCATTTTA
AAGATGGCCCAAACTGTGTGGAAAAATGTCCAGATGGCTTACAGGGGGCAAACAGTTTCATTTTCAAGTA
TGCTGATCCAGATCGGGAGTGCCACCCATGCCATCCAAACTGCACCCAAGGGTGTAACGGTCCCACTAGT
CATGACTGCATTTACTACCCATGGACGGGCCATTCCACTTTACCACAACATGCTAGAACTCCCCTGATTG
CAGCTGGAGTAATTGGTGGGCTCTTCATTCTGGTCATTGTGGGTCTGACATTTGCTGTTTATGTTAGAAG
GAAGAGCATCAAAAAGAAAAGAGCCTTGAGAAGATTCTTGGAAACAGAGTTGGTGGAACCATTAACTCCC
AGTGGCACAGCACCCAATCAAGCTCAACTTCGTATTTTGAAAGAAACTGAGCTGAAGAGGGTAAAAGTCC
TTGGCTCAGGTGCTTTTGGAACGGTTTATAAAGGTATTTGGGTACCTGAAGGAGAAACTGTGAAGATTCC
TGTGGCTATTAAGATTCTTAATGAGACAACTGGTCCCAAGGCAAATGTGGAGTTCATGGATGAAGCTCTG
ATCATGGCAAGTATGGATCATCCACACCTAGTCCGGTTGCTGGGTGTGTGTCTGAGCCCAACCATCCAGC
TGGTTACTCAACTTATGCCCCATGGCTGCCTGTTGGAGTATGTCCACGAGCACAAGGATAACATTGGATC
ACAACTGCTGCTTAACTGGTGTGTCCAGATAGCTAAGGGAATGATGTACCTGGAAGAAAGACGACTCGTT
CATCGGGATTTGGCAGCCCGTAATGTCTTAGTGAAATCTCCAAACCATGTGAAAATCACAGATTTTGGGC
TAGCCAGACTCTTGGAAGGAGATGAAAAAGAGTACAATGCTGATGGAGGAAAGATGCCAATTAAATGGAT
GGCTCTGGAGTGTATACATTACAGGAAATTCACCCATCAGAGTGACGTTTGGAGCTATGGAGTTACTATA
TGGGAACTGATGACCTTTGGAGGAAAACCCTATGATGGAATTCCAACGCGAGAAATCCCTGATTTATTAG
AGAAAGGAGAACGTTTGCCTCAGCCTCCCATCTGCACTATTGACGTTTACATGGTCATGGTCAAATGTTG
GATGATTGATGCTGACAGTAGACCTAAATTTAAGGAACTGGCTGCTGAGTTTTCAAGGATGGCTCGAGAC
CCTCAAAGATACCTAGTTATTCAGGGTGATGATCGTATGAAGCTTCCCAGTCCAAATGACAGCAAGTTCT
TTCAGAATCTCTTGGATGAAGAGGATTTGGAAGATATGATGGATGCTGAGGAGTACTTGGTCCCTCAGGC
TTTCAACATCCCACCTCCCATCTATACTTCCAGAGCAAGAATTGACTCGAATAGGAACCAGTTTGTATAC
CGAGATGGAGGTTTTGCTGCTGAACAAGGAGTGTCTGTGCCCTACAGAGCCCCAACTAGCACAATTCCAG
AAGCTCCTGTGGCACAGGGTGCTACTGCTGAGATTTTTGATGACTCCTGCTGTAATGGCACCCTACGCAA
GCCAGTGGCACCCCATGTCCAAGAGGACAGTAGCACCCAGAGGTACAGTGCTGACCCCACCGTGTTTGCC
CCAGAACGGAGCCCACGAGGAGAGCTGGATGAGGAAGGTTACATGACTCCTATGCGAGACAAACCCAAAC
AAGAATACCTGAATCCAGTGGAGGAGAACCCTTTTGTTTCTCGGAGAAAAAATGGAGACCTTCAAGCATT
GGATAATCCCGAATATCACAATGCATCCAATGGTCCACCCAAGGCCGAGGATGAGTATGTGAATGAGCCA
CTGTACCTCAACACCTTTGCCAACACCTTGGGAAAAGCTGAGTACCTGAAGAACAACATACTGTCAATGC
CAGAGAAGGCCAAGAAAGCGTTTGACAACCCTGACTACTGGAACCACAGCCTGCCACCTCGGAGCACCCT
TCAGCACCCAGACTACCTGCAGGAGTACAGCACAAAATATTTTTATAAACAGAATGGGCGGATCCGGCCT
ATTGTGGCAGAGAATCCTGAATACCTCTCTGAGTTCTCCCTGAAGCCAGGCACTGTGCTGCCGCCTCCAC
CTTACAGACACCGGAATACTGTGGTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG220500 representing NM_001042599
Red=Cloning site Green=Tags(s)

MKPATGLWVWVSLLVAAGTVQPSDSQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEH
NRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLT
EILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTR
TVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFN
AKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDS
SNIDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDN
RKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEFREFENGSICVECDPQCE
KMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCNGPTS
HDCIYYPWTGHSTLPQHARTPLIAAGVIGGLFILVIVGLTFAVYVRRKSIKKKRALRRFLETELVEPLTP
SGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEAL
IMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV
HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTI
WELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARD
PQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRNQFVY
RDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFA
PERSPRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHNASNGPPKAEDEYVNEP
LYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRP
IVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001042599
ORF Size 3876 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001042599.1, NP_001036064
RefSeq Size 11893
RefSeq ORF 3879
Locus ID 2066
Cytogenetics 2q34
Protein Families Protein Kinase, Transmembrane, Druggable Genome
Protein Pathways ErbB signaling pathway, Calcium signaling pathway, Endocytosis
Gene Summary This gene is a member of the Tyr protein kinase family and the epidermal growth factor receptor subfamily. It encodes a single-pass type I membrane protein with multiple cysteine rich domains, a transmembrane domain, a tyrosine kinase domain, a phosphotidylinositol-3 kinase binding site and a PDZ domain binding motif. The protein binds to and is activated by neuregulins and other factors and induces a variety of cellular responses including mitogenesis and differentiation. Multiple proteolytic events allow for the release of a cytoplasmic fragment and an extracellular fragment. Mutations in this gene have been associated with cancer. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)