TSH Receptor (TSHR) (NM_000369) Human Tagged ORF Clone

CAT#: RG220499

Reviews ()
Write a review
  • TrueORF®

TSHR (GFP-tagged) - Human thyroid stimulating hormone receptor (TSHR), transcript variant 1

  View "NM_000369" in other vectors (10)

USD 1,330.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name TSH Receptor (TSHR) (NM_000369) Human Tagged ORF Clone
Symbol TSHR
Synonyms CHNG1; hTSHR-I; LGR3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG220499 representing NM_000369
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGCCGGCGGACTTGCTGCAGCTGGTGCTGCTGCTCGACCTGCCCAGGGACCTGGGCGGAATGGGGT
GTTCGTCTCCACCCTGCGAGTGCCATCAGGAGGAGGACTTCAGAGTCACCTGCAAGGATATTCAACGCAT
CCCCAGCTTACCGCCCAGTACGCAGACTCTGAAGCTTATTGAGACTCACCTGAGAACTATTCCAAGTCAT
GCATTTTCTAATCTGCCCAATATTTCCAGAATCTACGTATCTATAGATGTGACTCTGCAGCAGCTGGAAT
CACACTCCTTCTACAATTTGAGTAAAGTGACTCACATAGAAATTCGGAATACCAGGAACTTAACTTACAT
AGACCCTGATGCCCTCAAAGAGCTCCCCCTCCTAAAGTTCCTTGGCATTTTCAACACTGGACTTAAAATG
TTCCCTGACCTGACCAAAGTTTATTCCACTGATATATTCTTTATACTTGAAATTACAGACAACCCTTACA
TGACGTCAATCCCTGTGAATGCTTTTCAGGGACTATGCAATGAAACCTTGACACTGAAGCTGTACAACAA
TGGCTTTACTTCAGTCCAAGGATATGCTTTCAATGGGACAAAGCTGGATGCTGTTTACCTAAACAAGAAT
AAATACCTGACAGTTATTGACAAAGATGCATTTGGAGGAGTATACAGTGGACCAAGCTTGCTGGACGTGT
CTCAAACCAGTGTCACTGCCCTTCCATCCAAAGGCCTGGAGCACCTGAAGGAACTGATAGCAAGAAACAC
CTGGACTCTTAAGAAACTTCCACTTTCCTTGAGTTTCCTTCACCTCACACGGGCTGACCTTTCTTACCCA
AGCCACTGCTGTGCTTTTAAGAATCAGAAGAAAATCAGAGGAATCCTTGAGTCCTTGATGTGTAATGAGA
GCAGTATGCAGAGCTTGCGCCAGAGAAAATCTGTGAATGCCTTGAATAGCCCCCTCCACCAGGAATATGA
AGAGAATCTGGGTGACAGCATTGTTGGGTACAAGGAAAAGTCCAAGTTCCAGGATACTCATAACAACGCT
CATTATTACGTCTTCTTTGAAGAACAAGAGGATGAGATCATTGGTTTTGGCCAGGAGCTCAAAAACCCCC
AGGAAGAGACTCTACAAGCTTTTGACAGCCATTATGACTACACCATATGTGGGGACAGTGAAGACATGGT
GTGTACCCCCAAGTCCGATGAGTTCAACCCGTGTGAAGACATAATGGGCTACAAGTTCCTGAGAATTGTG
GTGTGGTTCGTTAGTCTGCTGGCTCTCCTGGGCAATGTCTTTGTCCTGCTTATTCTCCTCACCAGCCACT
ACAAACTGAACGTCCCCCGCTTTCTCATGTGCAACCTGGCCTTTGCGGATTTCTGCATGGGGATGTACCT
GCTCCTCATCGCCTCTGTAGACCTCTACACTCACTCTGAGTACTACAACCATGCCATCGACTGGCAGACA
GGCCCTGGGTGCAACACGGCTGGTTTCTTCACTGTCTTTGCAAGCGAGTTATCGGTGTATACGCTGACGG
TCATCACCCTGGAGCGCTGGTATGCCATCACCTTCGCCATGCGCCTGGACCGGAAGATCCGCCTCAGGCA
CGCATGTGCCATCATGGTTGGGGGCTGGGTTTGCTGCTTCCTTCTCGCCCTGCTTCCTTTGGTGGGAATA
AGTAGCTATGCCAAAGTCAGTATCTGCCTGCCCATGGACACCGAGACCCCTCTTGCTCTGGCATATATTG
TTTTTGTTCTGACGCTCAACATAGTTGCCTTCGTCATCGTCTGCTGCTGTTATGTGAAGATCTACATCAC
AGTCCGAAATCCGCAGTACAACCCAGGGGACAAAGATACCAAAATTGCCAAGAGGATGGCTGTGTTGATC
TTCACCGACTTCATATGCATGGCCCCAATCTCATTCTATGCTCTGTCAGCAATTCTGAACAAGCCTCTCA
TCACTGTTAGCAACTCCAAAATCTTGCTGGTACTCTTCTATCCACTTAACTCCTGTGCCAATCCATTCCT
CTATGCTATTTTCACCAAGGCCTTCCAGAGGGATGTGTTCATCCTACTCAGCAAGTTTGGCATCTGTAAA
CGCCAGGCTCAGGCATACCGGGGGCAGAGGGTTCCTCCAAAGAACAGCACTGATATTCAGGTTCAAAAGG
TTACCCACGAGATGAGGCAGGGTCTCCACAACATGGAAGATGTCTATGAACTGATTGAAAACTCCCATCT
AACCCCAAAGAAGCAAGGCCAAATCTCAGAAGAGTATATGCAAACGGTTTTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG220499 representing NM_000369
Red=Cloning site Green=Tags(s)

MRPADLLQLVLLLDLPRDLGGMGCSSPPCECHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSH
AFSNLPNISRIYVSIDVTLQQLESHSFYNLSKVTHIEIRNTRNLTYIDPDALKELPLLKFLGIFNTGLKM
FPDLTKVYSTDIFFILEITDNPYMTSIPVNAFQGLCNETLTLKLYNNGFTSVQGYAFNGTKLDAVYLNKN
KYLTVIDKDAFGGVYSGPSLLDVSQTSVTALPSKGLEHLKELIARNTWTLKKLPLSLSFLHLTRADLSYP
SHCCAFKNQKKIRGILESLMCNESSMQSLRQRKSVNALNSPLHQEYEENLGDSIVGYKEKSKFQDTHNNA
HYYVFFEEQEDEIIGFGQELKNPQEETLQAFDSHYDYTICGDSEDMVCTPKSDEFNPCEDIMGYKFLRIV
VWFVSLLALLGNVFVLLILLTSHYKLNVPRFLMCNLAFADFCMGMYLLLIASVDLYTHSEYYNHAIDWQT
GPGCNTAGFFTVFASELSVYTLTVITLERWYAITFAMRLDRKIRLRHACAIMVGGWVCCFLLALLPLVGI
SSYAKVSICLPMDTETPLALAYIVFVLTLNIVAFVIVCCCYVKIYITVRNPQYNPGDKDTKIAKRMAVLI
FTDFICMAPISFYALSAILNKPLITVSNSKILLVLFYPLNSCANPFLYAIFTKAFQRDVFILLSKFGICK
RQAQAYRGQRVPPKNSTDIQVQKVTHEMRQGLHNMEDVYELIENSHLTPKKQGQISEEYMQTVL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_000369
ORF Size 2292 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000369.2, NP_000360
RefSeq Size 4410
RefSeq ORF 2295
Locus ID 7253
Cytogenetics 14q31.1
Protein Families Druggable Genome, GPCR, Transmembrane
Protein Pathways Autoimmune thyroid disease, Neuroactive ligand-receptor interaction
Gene Summary The protein encoded by this gene is a membrane protein and a major controller of thyroid cell metabolism. The encoded protein is a receptor for thyrothropin and thyrostimulin, and its activity is mediated by adenylate cyclase. Defects in this gene are a cause of several types of hyperthyroidism. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008]

Other Versions

Other products for "TSHR"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 618.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 299.00


Anti-TSHR Rabbit Polyclonal Antibody
    • 100 ul

USD 335.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones